Recombinant Bovine Uncharacterized protein C4orf34 homolog

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them when placing the order. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method or location. For specific delivery timeframes, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipment, please contact us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
SMIM14; Small integral membrane protein 14
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-99
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Names
SMIM14
Target Protein Sequence
MAEGGFDPCECVCSHEHAMRRLINLLRQSQSYCTDTECLQELPGPSSDNGISITMILMAW MVIAVILFLLRPPNLRGSNLTGKPASPHNGQDPPAPPVD
Uniprot No.

Target Background

Database Links
Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein.

Q&A

What is bovine C4orf34/SMIM14 and how does it compare to human orthologs?

Bovine C4orf34/SMIM14 belongs to a family of small integral membrane proteins highly conserved across vertebrate species. While initially annotated as an uncharacterized open reading frame on chromosome 4 in humans, research has established that C4orf34 is now alternatively known as SMIM14, reflecting its identification as a small integral membrane protein . The human version consists of 99 amino acids with a predicted molecular weight of approximately 10.5 kDa, and given the high sequence conservation observed between mammalian species, the bovine homolog is expected to exhibit similar physical characteristics . The protein demonstrates remarkable evolutionary conservation, with human and mouse versions sharing 89.7% amino acid identity, while zebrafish and Xenopus homologs maintain approximately 70% sequence identity with the human protein .

The bovine C4orf34/SMIM14 homolog, like its human counterpart, likely contains a single transmembrane domain (TMD) that plays a crucial role in its subcellular localization and function. Structural analysis of the human protein reveals a C-terminal region enriched in proline residues (9 out of 29 amino acids), featuring several proline-rich sequences (PXXP motifs) that potentially serve as binding sites for proteins containing SH3 domains . This structural feature suggests potential involvement in protein-protein interactions and signaling pathways, though these functions require experimental validation in the bovine homolog. When working with recombinant versions of this protein, researchers should consider these structural characteristics in experimental design.

What is the cellular localization and membrane topology of C4orf34/SMIM14?

C4orf34/SMIM14 has been definitively characterized as an endoplasmic reticulum (ER)-resident type I transmembrane protein in human cells . Type I transmembrane proteins have their N-terminal domain facing the ER lumen (or extracellular space if at the plasma membrane) while the C-terminal domain extends into the cytoplasm. Localization studies in mammalian cells have demonstrated that the protein predominantly resides in the ER membrane, suggesting it may play important roles in ER-associated functions such as calcium homeostasis, protein folding, or stress responses .

The transmembrane domain of C4orf34/SMIM14 appears to be instrumental in determining its subcellular localization, as mutational analysis has revealed that this domain is directly involved in ER retention . This finding suggests that the TMD contains specific amino acid sequences or structural features recognized by cellular machinery responsible for ER-resident protein retention. The presence of proline-rich sequences in the C-terminal domain further indicates potential interaction sites with other proteins, possibly connecting ER functions to other cellular processes. When designing experiments with bovine C4orf34/SMIM14, these localization characteristics should be considered, especially when using tagged versions that might interfere with proper membrane insertion or localization.

What are the expression patterns of C4orf34/SMIM14 in mammalian tissues?

Research has demonstrated that C4orf34/SMIM14 exhibits ubiquitous expression across various mammalian tissues, with particularly notable presence in the heart and brain of mice . This widespread expression pattern suggests that the protein likely performs fundamental cellular functions rather than highly specialized tissue-specific roles. The conservation of expression patterns across mammalian species further supports the notion that the bovine homolog would display similar tissue distribution.

Transcriptional analysis has confirmed the expression of C4orf34/SMIM14 mRNA in human cell lines, including HeLa cells, indicating its presence across diverse cell types . The ubiquitous nature of this protein's expression implies that it might serve as a housekeeping protein involved in basic cellular processes associated with ER function. When designing experiments to study bovine C4orf34/SMIM14, researchers should consider tissue selection based on expression levels, with cardiac and neural tissues potentially offering higher endogenous expression. The widespread expression also suggests that cell culture models of bovine origin would likely express the protein, facilitating in vitro studies without necessitating overexpression systems in many cases.

What are optimal methods for producing recombinant bovine C4orf34/SMIM14?

Based on established protocols for the human ortholog, recombinant bovine C4orf34/SMIM14 can be effectively produced using mammalian expression systems, particularly HEK293T cells . The mammalian expression system is preferable over bacterial systems when studying transmembrane proteins as it provides the appropriate cellular machinery for proper protein folding, post-translational modifications, and membrane insertion. The production process typically begins with cloning the bovine C4orf34 cDNA into an appropriate expression vector containing a strong promoter (such as CMV) and tags for detection and purification (commonly C-Myc/DDK or His tags) .

Transfection of the expression construct into HEK293T cells using lipid-based transfection reagents (such as Lipofectamine) generally yields good expression levels. After transfection, cells should be cultured for 48-72 hours to allow for optimal protein expression before harvesting . For purification of the recombinant protein, lysis conditions must be carefully optimized to solubilize the membrane-bound protein while maintaining its native conformation. Typically, this involves the use of mild detergents such as n-dodecyl-β-D-maltoside (DDM) or digitonin rather than harsher detergents that might denature the protein. Affinity chromatography using the incorporated tag allows for efficient purification, followed by optional size exclusion chromatography to enhance purity.

What validation methods ensure the integrity and functionality of recombinant C4orf34/SMIM14?

Multiple complementary approaches should be employed to validate the integrity and functionality of recombinant bovine C4orf34/SMIM14. SDS-PAGE coupled with Coomassie blue staining or Western blotting provides information about the protein's molecular weight, purity, and integrity . For the human ortholog, SDS-PAGE has confirmed a molecular weight of approximately 10.5 kDa, which should be similar for the bovine homolog with potential slight variations due to species-specific differences in amino acid composition . Purity levels of greater than 80% are typically achievable with optimized purification protocols, as determined by densitometric analysis of Coomassie-stained gels .

Functional validation requires assessing the protein's correct folding and membrane topology. Protease protection assays can determine whether the N-terminal domain is properly oriented in reconstituted proteoliposomes or membrane fractions. Circular dichroism spectroscopy provides information about secondary structure elements, which is particularly relevant for transmembrane proteins. To confirm proper subcellular localization, immunofluorescence microscopy using antibodies against the recombinant protein or its tag can visualize its distribution in transfected cells, with colocalization studies using ER markers (such as calnexin or PDI) confirming proper ER residence . For functional studies, researchers might consider calcium imaging or ER stress response assays, given the protein's potential involvement in these processes based on its ER localization.

What experimental approaches can identify interaction partners and function of C4orf34/SMIM14?

Given that C4orf34/SMIM14 contains proline-rich sequences in its C-terminal domain that could serve as binding sites for SH3 domain-containing proteins, several approaches can be employed to identify potential interaction partners . Immunoprecipitation followed by mass spectrometry (IP-MS) represents a powerful approach for identifying proteins that physically interact with C4orf34/SMIM14. This technique involves using antibodies against the recombinant protein or its tag to pull down the protein along with its binding partners from cell lysates, followed by mass spectrometric identification of the co-precipitated proteins.

Proximity-based labeling techniques such as BioID or APEX provide complementary approaches for identifying proteins in close proximity to C4orf34/SMIM14 in living cells. These methods involve fusing the protein of interest to a biotin ligase or peroxidase that biotinylates nearby proteins, which can then be purified using streptavidin and identified by mass spectrometry. For functional studies, CRISPR/Cas9-mediated knockout or knockdown using RNA interference (RNAi) can reveal phenotypic consequences of C4orf34/SMIM14 deficiency. Given its ER localization, assays monitoring calcium homeostasis (using fluorescent calcium indicators), ER stress responses (through XBP1 splicing, CHOP expression, or ATF6 cleavage), or protein folding and trafficking should be prioritized when investigating functional aspects of this protein in bovine cells or tissues.

How can mutational analysis of C4orf34/SMIM14 inform functional studies?

Mutational analysis represents a powerful approach for dissecting the functional domains of C4orf34/SMIM14, particularly given its established role as an ER-resident transmembrane protein. Previous research has demonstrated that the transmembrane domain (TMD) of C4orf34/SMIM14 is critically involved in ER retention, suggesting that mutations in this region could potentially alter the protein's subcellular localization and consequently its function . Systematic alanine scanning mutagenesis, where consecutive amino acids in the TMD are replaced with alanine residues, can identify specific residues crucial for ER retention. Additionally, chimeric constructs where the TMD is swapped with transmembrane domains from proteins targeted to different cellular compartments can further elucidate the specificity of the retention mechanism.

What are the challenges in studying species-specific differences of C4orf34/SMIM14?

Despite the high sequence conservation of C4orf34/SMIM14 across mammalian species (89.7% amino acid identity between human and mouse), subtle species-specific differences may significantly impact protein function, interaction partners, or regulatory mechanisms . A primary challenge in studying these differences lies in the limited availability of species-specific reagents, particularly antibodies that can distinguish between the bovine homolog and orthologs from other species. Researchers often need to develop and validate custom antibodies against species-specific epitopes or rely on epitope tags in recombinant expression systems, which may themselves influence protein behavior.

Another significant challenge involves distinguishing functionally relevant species-specific differences from natural sequence variations that do not affect function. This requires comprehensive comparative studies across species using identical experimental conditions and readouts. While CRISPR/Cas9 technology enables precise genome editing in many experimental systems, differences in transfection efficiency, guide RNA efficacy, and availability of well-characterized cell lines can make cross-species functional genomics studies technically challenging. When conducting experiments with the bovine homolog, researchers should carefully control for these variables by including appropriate controls, using multiple cell lines or primary cells when possible, and validating key findings using complementary techniques. Cross-species rescue experiments, where the bovine homolog is expressed in cells lacking the endogenous protein from another species, can provide particularly compelling evidence for functional conservation or divergence.

How does sequence conservation translate to functional conservation for C4orf34/SMIM14?

The high degree of sequence conservation observed for C4orf34/SMIM14 across vertebrate species strongly suggests functional conservation, but this relationship requires experimental validation. The table below summarizes the key comparative aspects of C4orf34/SMIM14 across different species based on available research data:

SpeciesAmino Acid Identity with Human (%)Predicted MW (kDa)Subcellular LocalizationExpression PatternFunctional Association
Human10010.5ER membrane (Type I)Ubiquitous, including HeLa cellsER functions including Ca²⁺ homeostasis and ER stress
Mouse89.7~10.5ER membrane (predicted)Ubiquitous, high in heart and brainSimilar to human (predicted)
BovineNot specified in data~10.5 (predicted)ER membrane (predicted)Ubiquitous (predicted)Similar to human (predicted)
Zebrafish69.7Not specifiedNot determinedNot determinedNot determined
Xenopus70.7Not specifiedNot determinedNot determinedNot determined

The amino acid sequence conservation is particularly strong in the transmembrane domain region, which has been experimentally shown to be critical for proper ER localization in human cells . This suggests that the bovine homolog likely shares the same subcellular localization. The high conservation in the proline-rich C-terminal domain further indicates preservation of potential protein-protein interaction sites across species. When designing cross-species functional studies, researchers should focus on these highly conserved regions while remaining attentive to subtle species-specific variations that might influence protein behavior.

While the table presents predictions for the bovine homolog based on evolutionary conservation, direct experimental validation is essential. Researchers working with the bovine protein should systematically assess its subcellular localization, expression pattern, and functional associations to determine the extent of conservation with human and mouse orthologs. Such comparative studies not only enhance our understanding of C4orf34/SMIM14 function but may also reveal species-specific adaptations of fundamental cellular processes.

What are optimal storage and handling conditions for recombinant C4orf34/SMIM14?

Proper storage and handling of recombinant C4orf34/SMIM14 is critical for maintaining protein integrity and functionality in experimental applications. Based on established protocols for the human ortholog, recombinant C4orf34/SMIM14 should be stored at -80°C in a buffer containing 25 mM Tris-HCl (pH 7.3), 100 mM glycine, and 10% glycerol . This formulation provides pH stability, prevents protein aggregation, and maintains protein solubility during freeze-thaw cycles. The protein preparation should be aliquoted before freezing to minimize the number of freeze-thaw cycles, as repeated freeze-thawing can lead to protein denaturation and loss of activity.

For shipping and transportation, the protein should be packed on dry ice to maintain the frozen state throughout transit . Upon receiving the protein, researchers should immediately transfer it to a -80°C freezer for long-term storage. When using the protein for experiments, thaw aliquots rapidly at room temperature or in a 37°C water bath, followed by immediate transfer to ice once thawed. For working solutions, dilution in appropriate experimental buffers should be performed just before use, and any remaining diluted protein should be discarded rather than refrozen. Under optimal storage conditions, recombinant C4orf34/SMIM14 remains stable for up to 12 months from the date of preparation . For applications requiring prolonged activity at higher temperatures, stability tests should be conducted to determine the protein's half-life under the specific experimental conditions.

How can researchers address inconsistent results in C4orf34/SMIM14 expression studies?

Inconsistent results in C4orf34/SMIM14 expression studies may stem from several technical and biological factors requiring systematic troubleshooting. First, the integrity of expression constructs should be verified through sequencing, as silent mutations or errors in the coding sequence can significantly impact protein expression or function. For quantitative PCR studies, primer design is crucial; primers should be validated for specificity, efficiency, and lack of secondary structure formation. In particular, ensure that primers can distinguish between closely related family members or splice variants that might exist for this gene.

Variability in transfection efficiency represents another common source of inconsistency, especially when studying membrane proteins like C4orf34/SMIM14. Researchers should optimize transfection conditions for their specific cell type and consistently monitor transfection efficiency using co-transfected reporter constructs or by measuring mRNA levels of the transfected gene. When analyzing protein expression, the choice of antibody is critical; commercial antibodies should be validated using positive and negative controls, including overexpression and knockout/knockdown systems. For the bovine homolog, potential cross-reactivity with homologs from other species should be carefully assessed, particularly in systems where multiple species' proteins might be present (such as cells cultured in serum from a different species).

What controls should be included in functional assays involving C4orf34/SMIM14?

Robust experimental design for functional studies of C4orf34/SMIM14 necessitates comprehensive controls to ensure valid and reproducible results. Positive controls should include well-characterized proteins known to function in the same cellular compartment or pathway as C4orf34/SMIM14. For example, when studying ER stress responses, established ER stress inducers like tunicamycin or thapsigargin serve as positive controls, while known ER-resident proteins such as calnexin or BiP can serve as comparative controls for localization studies.

Negative controls should include cells expressing vector alone (without the C4orf34/SMIM14 insert) processed identically to experimental samples to control for effects of the expression system itself. Additionally, functionally inactivated mutants of C4orf34/SMIM14 (such as transmembrane domain mutants that disrupt ER localization) provide valuable negative controls that help distinguish specific protein functions from potential artifacts. For knockdown or knockout studies, rescue experiments, where the phenotype is reversed by reintroducing the wild-type protein, provide compelling evidence for specificity. Dose-response experiments, where varying amounts of the recombinant protein are used, can establish whether observed effects are concentration-dependent, further supporting a specific functional role rather than an artifact of overexpression.

What are the potential roles of C4orf34/SMIM14 in ER functions and disease processes?

Given its localization to the ER membrane, C4orf34/SMIM14 likely plays important roles in ER-associated functions, with calcium homeostasis and ER stress responses being particularly promising areas for investigation . The ER serves as the primary intracellular calcium store, with precise regulation of calcium release and uptake being essential for numerous cellular processes, including protein folding, signaling, and cell death pathways. As a transmembrane protein residing in the ER, C4orf34/SMIM14 could potentially modulate calcium channel activity, interact with calcium-binding proteins, or influence the structural organization of calcium microdomains within the ER.

ER stress occurs when the protein folding capacity of the ER is overwhelmed, triggering the unfolded protein response (UPR) to restore homeostasis or, if unsuccessful, initiate apoptosis. Dysregulation of ER stress responses contributes to various pathologies, including neurodegenerative diseases, diabetes, and cancer. Future research should investigate whether C4orf34/SMIM14 modulates components of the UPR pathway, such as PERK, IRE1α, or ATF6, potentially through its proline-rich C-terminal domain that might mediate protein-protein interactions . High-throughput interactome studies coupled with functional assays measuring UPR activation would be particularly informative in delineating C4orf34/SMIM14's role in these processes. Additionally, comparative analysis of expression patterns in normal versus diseased tissues could reveal potential associations with specific pathological conditions, providing new insights into the physiological and pathophysiological significance of this evolutionarily conserved protein.

How might advanced technologies enhance our understanding of C4orf34/SMIM14 function?

Emerging technologies offer unprecedented opportunities to elucidate the function of previously uncharacterized proteins like C4orf34/SMIM14. Cryo-electron microscopy (cryo-EM) and structural prediction tools like AlphaFold can provide detailed structural information about membrane proteins, potentially revealing functional domains, interaction surfaces, and conformational states that might not be apparent from sequence analysis alone. These structural insights can guide rational mutagenesis approaches and facilitate structure-based drug design for targeting C4orf34/SMIM14 in research or therapeutic contexts.

Single-cell technologies represent another frontier for understanding C4orf34/SMIM14 function. Single-cell RNA sequencing can reveal cell type-specific expression patterns and identify co-expressed genes that might function in common pathways, while spatial transcriptomics can map expression within complex tissues with unprecedented resolution. Meanwhile, advances in genome editing, particularly base editing and prime editing, enable precise manipulation of endogenous C4orf34/SMIM14 without introducing double-strand breaks, facilitating the creation of specific mutations to test functional hypotheses. Finally, the development of organoid culture systems that recapitulate complex tissue architecture and function provides physiologically relevant models for studying C4orf34/SMIM14 in different organ contexts. Combining these technologies in integrated research programs would significantly accelerate our understanding of this evolutionarily conserved but still poorly characterized protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.