Recombinant Bovine UPF0414 transmembrane protein C20orf30 homolog

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Bovine UPF0414 Transmembrane Protein C20orf30 Homolog

The "Recombinant Bovine UPF0414 transmembrane protein C20orf30 homolog" refers to a protein that is similar to the human transmembrane protein 230 (TMEM230) . The term "UPF0414" indicates a protein of unknown function, and "C20orf30" refers to a specific region on chromosome 20 where the gene is located . The protein is a transmembrane protein, meaning it spans the cell membrane . The "bovine" part specifies that this protein is found in cows, and "recombinant" suggests it was produced using genetic engineering techniques.

Nomenclature and Synonyms:

  • Symbol: TMEM230

  • Name: transmembrane protein 230

  • Synonyms: A wide variety of names, including UPF0414 transmembrane protein C20orf30 homolog

Homology and Function

The mentioned protein is a homolog of the human TMEM230 protein . Homologs are genes or proteins that share a common ancestry and, therefore, structural and functional similarities .

How to find a homolog for a gene in another organism:

  1. Search the HomoloGene database with the gene name .

  2. If the search finds multiple records, click on the desired record. The homologous genes are listed at the top of the report .

  3. If the HomoloGene search returns no records, search the Gene database with the gene name .

  4. Click on the desired record, and then click on the HomoloGene link .

  5. If there is no link to HomoloGene, locate a protein Reference Sequence (e.g. NP_005537) in the NCBI Reference Sequences section of the Gene record .

TMEM230 and Parkinson's Disease

Research suggests that TMEM230 is associated with Parkinson's disease . One study suggested TMEM230 mutations may not play a role in the development of familial Parkinson's disease . The rat homolog of TMEM230 has been directly linked as a marker/mechanism in Parkinson's disease .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
TMEM230; Transmembrane protein 230
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-120
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Names
TMEM230
Target Protein Sequence
MMPSRTNLATGIPSSKVKYSRLSSTDDGYIDLQFKKSPPKIPYKAIALATVLFLIGAFLI IIGSLLLAGYISKGGADRAVPVLIIGILVFLPGFYHLRIAYYASKGYRGYSYDDIPDFDD
Uniprot No.

Target Background

Function

This protein is involved in the trafficking and recycling of synaptic vesicles.

Database Links
Protein Families
TMEM134/TMEM230 family
Subcellular Location
Membrane; Multi-pass membrane protein. Golgi apparatus, trans-Golgi network. Cytoplasmic vesicle, secretory vesicle, synaptic vesicle. Early endosome. Recycling endosome. Late endosome. Cytoplasmic vesicle, autophagosome.

Q&A

What is the optimal western blotting protocol for Recombinant Bovine UPF0414 transmembrane protein C20orf30 homolog?

The optimal western blotting protocol for Recombinant Bovine UPF0414 transmembrane protein C20orf30 homolog involves careful sample preparation and electrophoresis conditions. Begin by running SDS-PAGE at 12.5mA per mini-gel for approximately 1.5 hours in running buffer containing 25mM Tris, 192mM Glycine, and 0.1% SDS. Transfer the separated proteins to a PVDF membrane using a transfer buffer (25mM Tris pH 8.3, 192mM Glycine, and 20% methanol) at 300mA and 4°C for 1.5-2 hours. Block the membrane for 20-30 minutes at room temperature in either 1% BSA or 5% skim milk dissolved in 0.1% Tween 20-containing Tris-buffered saline (TBS: 20mM Tris-HCl pH 7.6 and 137mM NaCl). Incubate with a primary antibody specific to the target protein on a rocker platform at 4°C overnight for optimal results . This protocol has been optimized to minimize protein aggregation and maximize detection sensitivity for transmembrane proteins.

How should I store Recombinant Bovine UPF0414 transmembrane protein C20orf30 homolog to maintain stability?

Proper storage of Recombinant Bovine UPF0414 transmembrane protein C20orf30 homolog is critical for maintaining its stability and biological activity. For short-term storage (1-2 weeks), keep the protein at 4°C in a buffer containing appropriate stabilizers such as glycerol or sucrose. For long-term storage, aliquot the protein solution to minimize freeze-thaw cycles and store at -80°C. The storage buffer should be optimized to maintain the native conformation of the transmembrane protein, typically including a non-ionic detergent at concentrations above its critical micelle concentration to prevent protein aggregation. Regular stability testing using techniques such as circular dichroism spectroscopy or size-exclusion chromatography is recommended to confirm protein integrity before experimental use.

What are the recommended antibody dilutions for detecting Recombinant Bovine UPF0414 transmembrane protein C20orf30 homolog?

When detecting Recombinant Bovine UPF0414 transmembrane protein C20orf30 homolog, antibody dilution optimization is essential for specific and sensitive detection. Primary antibodies against this protein typically work best at dilutions ranging from 1:500 to 1:2000 in western blotting applications, though this must be empirically determined for each antibody batch. For immunofluorescence applications, a starting dilution of 1:200 is recommended with subsequent optimization. Secondary antibodies conjugated to horseradish peroxidase (HRP) for western blotting are generally effective at 1:5000 to 1:10000 dilutions. Always include appropriate positive and negative controls to validate antibody specificity, and consider using recombinant standards of known concentration to establish a detection curve for quantitative applications.

How can I overcome aggregation issues when working with Recombinant Bovine UPF0414 transmembrane protein C20orf30 homolog?

Overcoming aggregation of Recombinant Bovine UPF0414 transmembrane protein C20orf30 homolog requires a multi-faceted approach to sample preparation and handling. First, optimize the detergent type and concentration in your buffer system, testing various non-ionic (Triton X-100, NP-40) and zwitterionic (CHAPS, DDM) detergents. Second, incorporate chaotropic agents such as urea (1-2M) or guanidine hydrochloride (0.5-1M) at concentrations that disrupt protein-protein interactions without denaturing the protein of interest. Third, adjust the ionic strength of your buffer, as high salt concentrations (150-300mM NaCl) can help reduce electrostatic interactions leading to aggregation. Fourth, consider adding stabilizing agents such as glycerol (5-10%) or specific lipids that mimic the native membrane environment. Finally, always maintain your samples at appropriate temperatures (typically 4°C) and minimize freeze-thaw cycles by preparing single-use aliquots for long-term storage .

What experimental approaches can validate the functional activity of Recombinant Bovine UPF0414 transmembrane protein C20orf30 homolog?

Validating the functional activity of Recombinant Bovine UPF0414 transmembrane protein C20orf30 homolog requires multiple complementary experimental approaches. Begin with structural integrity assessment using circular dichroism spectroscopy to confirm proper protein folding. For transmembrane proteins, reconstitution into artificial liposomes or nanodiscs can provide a native-like membrane environment for functional studies. Specific binding assays using surface plasmon resonance (SPR) or microscale thermophoresis (MST) can quantify interactions with potential ligands or binding partners. For transmembrane proteins involved in transport, liposome-based flux assays measuring the movement of ions or small molecules across the membrane are essential. Cell-based assays in which the recombinant protein is expressed in appropriate cell lines can validate its localization to membranes and any downstream signaling effects. Finally, site-directed mutagenesis of conserved residues followed by activity comparisons can map functional domains within the protein.

How does sample preparation affect the detection of post-translational modifications in Recombinant Bovine UPF0414 transmembrane protein C20orf30 homolog?

Sample preparation significantly impacts the detection of post-translational modifications (PTMs) in Recombinant Bovine UPF0414 transmembrane protein C20orf30 homolog. Harsh detergents and reducing agents can disrupt certain PTMs, particularly those involving disulfide bonds. To preserve phosphorylation, include phosphatase inhibitors (sodium orthovanadate, sodium fluoride, and β-glycerophosphate) in lysis buffers. For glycosylation analysis, avoid deglycosylating enzymes in your sample preparation workflow and consider specialized glycoprotein staining methods. Ubiquitination and SUMOylation are best preserved by including deubiquitinating enzyme inhibitors and performing lysis under denaturing conditions. Temperature control during sample preparation is critical, as heat can accelerate the loss of some labile modifications. Mass spectrometry-based approaches offer the most comprehensive PTM characterization but require careful sample enrichment strategies specific to each modification type. Consider using complementary techniques such as western blotting with modification-specific antibodies to validate mass spectrometry findings .

How can I design experiments to investigate protein-protein interactions involving Recombinant Bovine UPF0414 transmembrane protein C20orf30 homolog?

Designing experiments to investigate protein-protein interactions involving Recombinant Bovine UPF0414 transmembrane protein C20orf30 homolog requires careful consideration of the membrane environment. Begin with in silico prediction tools to identify potential interaction partners based on structural motifs, evolutionary conservation, or co-expression patterns. For in vitro studies, co-immunoprecipitation with specific antibodies can capture protein complexes, followed by mass spectrometry for unbiased identification of interaction partners. Proximity labeling techniques such as BioID or APEX2 are particularly valuable for transmembrane proteins, as they can identify transient interactions within the membrane environment. Fluorescence resonance energy transfer (FRET) or bimolecular fluorescence complementation (BiFC) provides spatial information about interactions in living cells. For validation, direct binding assays using purified recombinant proteins in detergent micelles or reconstituted into liposomes, coupled with techniques like isothermal titration calorimetry or SPR, can quantify binding affinities and kinetics. Always include appropriate controls for each technique, such as non-interacting protein pairs and known interactors.

How can I troubleshoot poor expression yields of Recombinant Bovine UPF0414 transmembrane protein C20orf30 homolog?

Troubleshooting poor expression yields of Recombinant Bovine UPF0414 transmembrane protein C20orf30 homolog requires systematic investigation of multiple parameters. First, evaluate your expression system - bacterial systems like E. coli may struggle with proper folding of mammalian transmembrane proteins, so consider eukaryotic systems such as insect cells (Sf9, High Five) or mammalian cells (HEK293, CHO). Second, optimize codon usage for your expression host to improve translation efficiency. Third, test different fusion tags (His, GST, MBP) and their positions (N-terminal vs. C-terminal) to enhance solubility and expression. Fourth, modulate expression conditions including temperature (reducing to 16-25°C can improve folding), inducer concentration, and duration of expression. Fifth, co-express with molecular chaperones that facilitate membrane protein folding. Sixth, for bacterial systems, consider specialized strains designed for membrane protein expression (C41(DE3), C43(DE3)). Finally, optimize lysis and extraction conditions using different detergents and buffer compositions to improve recovery of correctly folded protein from membranes.

What are the common sources of background signals in western blots for Recombinant Bovine UPF0414 transmembrane protein C20orf30 homolog and how to minimize them?

Common sources of background signals in western blots for Recombinant Bovine UPF0414 transmembrane protein C20orf30 homolog can significantly impact data interpretation. Non-specific antibody binding is a primary concern that can be addressed by optimizing blocking conditions (testing different blocking agents such as BSA, milk, casein, or commercial alternatives) and increasing blocking time from 30 minutes to 2 hours. Inadequate washing contributes to background, so implement more stringent washing steps (4-5 washes of 5-10 minutes each) with buffers containing appropriate detergent concentrations (0.05-0.1% Tween-20). Cross-reactivity of antibodies can be minimized by using affinity-purified antibodies and pre-absorbing with non-specific proteins. Excessive secondary antibody concentration is a common issue; dilute to 1:5000-1:10000 and optimize through titration experiments. Membrane overexposure during detection can be addressed by reducing exposure time or substrate concentration. For transmembrane proteins specifically, complete solubilization is critical to prevent aggregation artifacts appearing as high-molecular-weight smears . Finally, proper negative controls (no primary antibody, isotype controls) should be included in each experiment to distinguish specific from non-specific signals.

How can I optimize protein reconstitution procedures for functional studies of Recombinant Bovine UPF0414 transmembrane protein C20orf30 homolog?

Optimizing protein reconstitution procedures for functional studies of Recombinant Bovine UPF0414 transmembrane protein C20orf30 homolog requires careful consideration of membrane mimetics and reconstitution methods. Begin by selecting appropriate membrane mimetics - detergent micelles provide simplicity but limited stability, while liposomes better mimic native membranes but present reconstitution challenges. Nanodiscs and lipid cubic phases offer intermediate options with improved stability and native-like environments. The lipid composition significantly impacts protein function; systematically test various lipid mixtures including phosphatidylcholine, phosphatidylethanolamine, phosphatidylserine, and cholesterol at different ratios to identify optimal conditions. For liposome reconstitution, compare gentle methods like detergent dialysis with more disruptive techniques such as sonication or extrusion, monitoring protein orientation using protease protection assays. The protein-to-lipid ratio requires careful optimization, typically ranging from 1:50 to 1:1000 (w/w), as too much protein can destabilize membranes while too little may yield insufficient signal. After reconstitution, verify protein incorporation and structural integrity using techniques such as electron microscopy, dynamic light scattering, and circular dichroism before proceeding to functional assays.

What mass spectrometry approaches are most effective for characterizing Recombinant Bovine UPF0414 transmembrane protein C20orf30 homolog?

Mass spectrometry characterization of Recombinant Bovine UPF0414 transmembrane protein C20orf30 homolog requires specialized approaches for hydrophobic membrane proteins. Bottom-up proteomics involving enzymatic digestion (typically using trypsin, chymotrypsin, or a combination) followed by LC-MS/MS analysis provides peptide-level information but may result in poor coverage of transmembrane regions. To address this limitation, use alternative proteases like pepsin or proteinase K that generate different cleavage patterns. For intact mass analysis, electrospray ionization with high-resolution instruments (Orbitrap, QTOF) after extraction in MS-compatible detergents like lauryl maltose neopentyl glycol (LMNG) provides accurate molecular weight determination. Hydrogen-deuterium exchange mass spectrometry (HDX-MS) offers valuable structural information by measuring solvent accessibility of different protein regions. For post-translational modification mapping, employ enrichment strategies specific to the modification of interest (e.g., TiO2 for phosphopeptides, lectin affinity for glycopeptides) prior to MS analysis. Native MS approaches, while challenging for membrane proteins, can provide insights into oligomeric states and non-covalent interactions when conducted in appropriate detergent micelles or nanodiscs with careful instrument optimization.

How can I use computational approaches to predict structure-function relationships in Recombinant Bovine UPF0414 transmembrane protein C20orf30 homolog?

Computational approaches provide valuable insights into structure-function relationships of Recombinant Bovine UPF0414 transmembrane protein C20orf30 homolog when experimental structural data is limited. Begin with homology modeling using related proteins with known structures as templates, leveraging specialized membrane protein-specific tools like MEMOIR or MEDELLER that account for the unique constraints of the membrane environment. For transmembrane topology prediction, combine results from multiple algorithms (TMHMM, TOPCONS, MEMSAT) to increase confidence in domain assignments. Molecular dynamics simulations in explicit lipid bilayers can reveal dynamic behaviors, conformational flexibility, and lipid-protein interactions over nanosecond to microsecond timescales. Coarse-grained simulations extend accessible timescales to milliseconds, enabling observation of larger conformational changes. Evolutionary coupling analysis identifies co-evolving residue pairs that likely interact in the three-dimensional structure, providing constraints for structural modeling. For functional site prediction, combine conservation analysis, electrostatic surface mapping, and geometric feature recognition to identify potential binding pockets or catalytic sites. Integrate experimental data such as cross-linking constraints or mutagenesis results to validate and refine computational models iteratively.

Data Table: Experimental Conditions for Recombinant Bovine UPF0414 Transmembrane Protein C20orf30 Homolog Analysis

Analytical TechniqueSample PreparationBuffer CompositionDetection MethodSensitivity RangeKey Considerations
Western BlottingSDS-PAGE at 12.5mA/gel for 1.5hr; transfer at 300mA, 4°C for 1.5-2hrRunning: 25mM Tris, 192mM Glycine, 0.1% SDS; Transfer: 25mM Tris, 192mM Glycine, 20% methanolChemiluminescence or fluorescence1-10 ng proteinBlock with 1% BSA or 5% skim milk; overnight primary antibody incubation at 4°C
Mass SpectrometryIn-gel or in-solution digestion with trypsin and chymotrypsin50mM ammonium bicarbonate, pH 8.0LC-MS/MS with CID or HCD fragmentation10-100 fmolUse alternative proteases for improved transmembrane domain coverage
Circular DichroismPurified protein in detergent micelles or liposomes10mM phosphate buffer, pH 7.4, with appropriate detergentFar-UV (190-260 nm) spectrum0.1-1 mg/mLMinimize chloride ions and absorbing detergents
Surface Plasmon ResonanceImmobilization via His-tag on NTA chipHBS-P (10mM HEPES pH 7.4, 150mM NaCl, 0.005% surfactant P20)Real-time binding kineticsKD: nM-μM rangeInclude detergent above CMC in all buffers
Reconstitution for Functional AssaysDetergent-mediated incorporation into liposomes20mM HEPES pH 7.4, 100mM KCl, 0.5-2% appropriate detergentFluorescence or radioactive flux assaysN/AProtein:lipid ratio 1:100-1:1000 (w/w); verify orientation

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.