Recombinant Bovine UPF0694 transmembrane protein C14orf109 homolog

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
TMEM251; Transmembrane protein 251
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-163
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Names
TMEM251
Target Protein Sequence
MPKPPDYSELSDSLTLAVGTGRFSGPLHRAWRMMNFRQRMGWIGVGLYLLASAAAFYYVF EINETYNRLALEHIQQHPEEPLEGTTWTHSLKTRLLSLPFWFWTVVFLIPYLQMFLFLYS CTRADPKTVGYCIIPICLAVICNRHQAFVKASNQISRLQLIDT
Uniprot No.

Target Background

Database Links

KEGG: bta:768076

UniGene: Bt.28166

Protein Families
TMEM251 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is UPF0694 transmembrane protein C14orf109 homolog and what are its alternative nomenclatures?

UPF0694 transmembrane protein C14orf109 homolog is a transmembrane protein that belongs to the UPF0694 protein family, originally identified on chromosome 14 in humans but with homologs present across multiple species including bovine. In bovine species, this protein is also identified by the gene names TMEM251 and C21H14orf109, with TMEM251 (transmembrane protein 251) being the more commonly used designation in recent literature . The "UPF" prefix indicates that this protein belongs to a family of uncharacterized protein families, specifically family number 0694, which suggests that the full functional characterization of this protein is still emerging in the scientific literature. The protein is conserved across numerous vertebrate species including humans, bovine, mouse, chicken, pig, and various aquatic species, indicating potential evolutionary significance .

What expression systems are typically used for producing this recombinant protein?

Recombinant Bovine UPF0694 transmembrane protein C14orf109 homolog is predominantly produced using cell-free expression systems, which offer several advantages for membrane protein production compared to traditional cell-based systems . Cell-free expression systems bypass the toxicity often associated with overexpression of membrane proteins in living cells, allowing for higher yields and functional integrity of the target protein. For researchers requiring alternative expression approaches, the protein can also be produced using E. coli, yeast, baculovirus, or mammalian cell expression systems, each with specific optimization requirements . E. coli remains the most widely used host system for recombinant protein expression due to its rapid growth, well-characterized genetics, and relatively low cost, making it suitable for initial characterization studies of membrane proteins .

What purification methods yield the highest quality preparations of this protein?

The purification of Recombinant Bovine UPF0694 transmembrane protein C14orf109 homolog typically employs SDS-PAGE as a quality control method, with commercial preparations achieving greater than or equal to 85% purity . For transmembrane proteins like C14orf109 homolog, effective purification protocols generally involve a multi-step process beginning with careful cell lysis using detergents that can solubilize membrane proteins without denaturing them. Affinity chromatography is commonly employed, often utilizing tags such as poly-histidine incorporated into the recombinant construct, followed by size exclusion chromatography to remove aggregates and increase homogeneity. The choice of detergent is critical during purification, with milder detergents such as n-dodecyl-β-D-maltoside (DDM) or n-octyl-β-D-glucopyranoside (OG) often preferred to maintain protein structure and function throughout the purification process .

What structural characterization techniques are most suitable for this transmembrane protein?

Structural characterization of Recombinant Bovine UPF0694 transmembrane protein C14orf109 homolog can be approached through multiple complementary techniques. X-ray diffraction (XRD) remains a gold standard for atomic resolution structural determination, but requires successful crystallization of the membrane protein, which presents significant challenges including protein stability in detergent solutions and crystal packing . Nuclear magnetic resonance spectroscopy (NMR) offers versatility for studying both structure and dynamics, with solution-state NMR applicable for smaller constructs and solid-state NMR allowing characterization in more native-like lipid environments . Cryo-electron microscopy (cryo-EM) has emerged as a powerful alternative, particularly for larger membrane protein complexes, bypassing the need for crystallization and potentially preserving the protein in a more native-like state. The selection of the appropriate technique depends on specific research questions, available facilities, and the biochemical properties of the particular construct being studied .

How can researchers optimize expression yields for structural and functional studies?

Optimizing expression yields of Recombinant Bovine UPF0694 transmembrane protein C14orf109 homolog requires systematic evaluation of multiple parameters. For cell-free expression systems, which have shown success with this protein, optimization involves adjusting reaction components including template concentration, energy regeneration systems, and redox conditions . When using cellular expression systems like E. coli, researchers should evaluate multiple strains (e.g., BL21(DE3), C41(DE3), C43(DE3)) specifically developed for membrane protein expression, while also optimizing induction conditions (temperature, inducer concentration, and duration) to balance protein production against potential toxicity effects. Fusion partners such as maltose-binding protein (MBP) or thioredoxin (Trx) can enhance solubility and expression levels, while careful codon optimization accounting for the host organism's codon bias can significantly improve translation efficiency. The addition of specific lipids or mild detergents during expression can also facilitate proper folding and membrane insertion, particularly in cell-free systems where the composition of the reaction mixture can be precisely controlled .

How can researchers address stability issues with this transmembrane protein during purification and analysis?

Maintaining stability of Recombinant Bovine UPF0694 transmembrane protein C14orf109 homolog throughout purification and subsequent analysis presents significant challenges common to membrane proteins. Researchers should implement a stability screening approach, systematically testing various detergents (ranging from harsh ionic detergents like SDS to milder non-ionic options like DDM) at different concentrations to identify optimal solubilization conditions. Temperature modulation during purification processes can dramatically impact stability, with reduced temperatures (4°C) typically decreasing protein degradation and aggregation while potentially slowing purification kinetics. Addition of specific lipids that may interact with the transmembrane domains can significantly enhance stability by mimicking the native membrane environment from which the protein was extracted. Incorporation of stability-enhancing additives such as glycerol (10-20%), specific salt concentrations, or reducing agents may preserve structural integrity throughout handling. For particularly challenging constructs, protein engineering approaches—introducing thermostabilizing mutations, removing flexible regions, or fusion with stability-enhancing partners—can be implemented based on comparative sequence analysis with homologs from thermophilic organisms .

What strategies can resolve expression challenges specific to this bovine transmembrane protein?

When encountering expression difficulties with Recombinant Bovine UPF0694 transmembrane protein C14orf109 homolog, researchers can implement several targeted strategies to improve outcomes. Construct optimization represents a critical first approach, where systematic truncation or extension of the terminal regions can identify constructs with improved expression characteristics while maintaining functional domains. Expression vector selection significantly impacts results, with vectors containing tightly regulated promoters often yielding better results for potentially toxic membrane proteins compared to high-expression systems. For E. coli expression, specialized strains like C41(DE3) and C43(DE3) were specifically developed for membrane protein expression and often outperform standard BL21(DE3) for challenging transmembrane proteins. Expression conditions require systematic optimization, including induction at lower temperatures (16-20°C instead of 37°C), reduced inducer concentrations, and extended expression times to promote proper folding rather than inclusion body formation. For researchers encountering persistent difficulties with conventional systems, switching to alternative expression platforms such as cell-free systems (as commonly used for this protein) eliminates cellular toxicity concerns while allowing direct manipulation of the reaction environment to support membrane protein folding .

How does bovine UPF0694 transmembrane protein C14orf109 homolog compare structurally and functionally to homologs in other species?

Comparative analysis reveals that UPF0694 transmembrane protein C14orf109 homolog is conserved across numerous vertebrate species with varying nomenclature. In humans, it is designated as C14orf109 or TMEM251; in mouse as Tmem251 or D230037D09Rik; in chicken as RP11-371E8.4, TMEM251, or C5H14orf109; in Xenopus as tmem251 or c14orf109; and in zebrafish as tmem251, zgc:112233, or si:dkeyp-55f12.4 . This conservation across evolutionary distant species suggests fundamental biological importance, despite limited functional characterization in the scientific literature. Sequence alignment analysis would likely reveal conserved transmembrane domains and potential functional motifs that have been maintained through evolutionary history. While specific functional studies comparing these homologs appear limited in current literature, the consistent renaming to TMEM251 across multiple species indicates recognition of shared structural characteristics as transmembrane elements. Structural prediction algorithms would likely identify similar membrane topology across species, with potential species-specific variations in cytoplasmic or extracellular domains that could relate to specialized functions within different cellular contexts or tissue environments .

What experimental design considerations are crucial when studying effects of this protein on cellular metabolism?

When designing experiments to investigate metabolic effects of Recombinant Bovine UPF0694 transmembrane protein C14orf109 homolog, researchers must implement rigorous controls and appropriate statistical approaches. Experimental designs should include multiple biological replicates (typically minimum n=3) and technical replicates to account for variability, with power analysis performed prior to experimentation to ensure sufficient sample sizes . Control groups must be carefully selected, including both negative controls (vehicle-treated or expressing control proteins) and positive controls when available. While not directly studying our protein of interest, studies of other recombinant proteins show methodological approaches relevant to metabolic investigations, such as measurements of glycogen reserves, RNA concentration, RNA/DNA ratios, and isotopic analysis (δ13C and δ15N) to track metabolic changes . When analyzing resulting data, appropriate statistical tests must be selected based on experimental design and data characteristics, with consideration of normality, homoscedasticity, and independence of observations. Analysis of variance (ANOVA) models are particularly useful for complex experimental designs with multiple factors, while regression models can elucidate relationships between protein expression levels and metabolic parameters .

What approaches are most effective for detecting protein-protein interactions involving this transmembrane protein?

Identifying protein-protein interactions involving Recombinant Bovine UPF0694 transmembrane protein C14orf109 homolog requires specialized approaches suitable for membrane proteins. Affinity purification coupled with mass spectrometry (AP-MS) represents a powerful initial approach when performed with appropriate detergent solubilization to maintain native interactions, typically using mild non-ionic detergents like digitonin or DDM at carefully optimized concentrations. Proximity-based labeling methods, including BioID or APEX, offer significant advantages for transmembrane proteins by allowing identification of both stable and transient interactors in living cells without requiring membrane disruption, through fusion of the biotin ligase or peroxidase enzyme to the target protein. Cross-linking mass spectrometry can capture direct interaction interfaces by covalently linking proteins in close proximity before analysis, with MS-cleavable crosslinkers providing enhanced confidence in identified partners. For validation of specific interactions, researchers should employ orthogonal methods such as co-immunoprecipitation, FRET/BRET analysis, or split-reporter systems (like split-GFP or split-luciferase), each with specific optimization requirements for membrane proteins. When interpreting interaction data, rigorous statistical analysis must distinguish true interactors from background contaminants, typically using comparison to control samples and statistical tools like SAINT (Significance Analysis of INTeractome) specifically developed for interaction proteomics .

What emerging technologies might advance structural and functional studies of this protein?

Emerging technologies offer promising avenues for deepening our understanding of Recombinant Bovine UPF0694 transmembrane protein C14orf109 homolog. Single-particle cryo-electron microscopy continues to advance rapidly, with improved detectors and processing algorithms potentially enabling structural determination of smaller membrane proteins like C14orf109 homolog without requiring crystallization. Innovations in mass spectrometry, particularly native MS approaches allowing analysis of intact membrane proteins with bound lipids, could reveal critical protein-lipid interactions that influence structure and function. Integrative structural biology approaches combining multiple experimental techniques (crystallography, NMR, cryo-EM, SAXS, crosslinking-MS) with computational modeling will likely provide more complete structural insights than any single method alone. For functional characterization, advances in genome editing technologies like CRISPR-Cas9 enable precise manipulation of endogenous C14orf109 homolog in cellular models to assess physiological functions. Single-molecule techniques, including single-molecule FRET and high-speed atomic force microscopy, are increasingly applicable to membrane proteins and could reveal dynamic conformational changes related to function that are inaccessible to ensemble measurements .

How might researchers effectively investigate the physiological roles of this relatively uncharacterized protein?

Investigating the physiological functions of Recombinant Bovine UPF0694 transmembrane protein C14orf109 homolog requires a multi-faceted approach combining genetic, biochemical, and cellular methods. Gene silencing through siRNA or CRISPR-Cas9 knockout/knockdown in relevant bovine cell lines, followed by comprehensive phenotypic characterization including transcriptomics, proteomics, and metabolomics analysis, can identify pathways and processes affected by protein depletion. Complementary overexpression studies using carefully regulated expression systems can reveal gain-of-function phenotypes while avoiding potential artifacts from excessive protein levels. Tissue distribution analysis using quantitative PCR, western blotting, or immunohistochemistry can identify physiologically relevant sites of expression, guiding selection of appropriate cell types for detailed investigation. Interactome mapping using the protein-protein interaction techniques previously discussed can place the protein within cellular signaling or structural networks. For transmembrane proteins like C14orf109 homolog, subcellular localization studies using fluorescent protein fusions or immunofluorescence microscopy with domain-specific antibodies can provide critical insights into potential functions based on residency in specific cellular compartments or membrane domains.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.