Recombinant Bovine UPF0697 protein C8orf40 homolog

Shipped with Ice Packs
In Stock

Description

Production and Purification

The protein is synthesized using recombinant DNA technology in various host systems, including E. coli, yeast, Baculovirus, and mammalian cells . Key production parameters include:

ParameterDetails
Host SystemsE. coli (most common), yeast, Baculovirus, mammalian cells
Tag InformationN-terminal His tag (standard for E. coli expression) ; C-terminal tags may vary
Purity≥85% (SDS-PAGE) ; >90% for His-tagged E. coli variants
Molecular Weight12,336 Da (calculated)

The protein is lyophilized or supplied in liquid form (Tris/PBS-based buffer with trehalose) . Storage at -20°C/-80°C is recommended to maintain stability .

Challenges and Considerations

  • Solubility and Aggregation: Recombinant UPF0697 may form inclusion bodies (IBs) in E. coli, requiring mild detergent solubilization .

  • Endotoxin and Sterility: Low-endotoxin variants and sterile filtration are optional but critical for in vivo applications .

  • Cross-Species Utility: Bovine UPF0697 serves as a model for studying human C8orf40, but sequence divergence (e.g., N-terminal extensions) may limit direct functional extrapolation .

Future Directions

Further research is needed to:

  1. Elucidate Functional Roles: Investigate interactions with membrane proteins or signaling pathways.

  2. Optimize Production: Improve folding efficiency to reduce aggregation and enhance yield.

  3. Structural Characterization: Use X-ray crystallography or cryo-EM to resolve conformational states.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it during order placement. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. For precise delivery estimates, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize its development.
Synonyms
SMIM19; Small integral membrane protein 19
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-107
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Names
SMIM19
Target Protein Sequence
MPGGYGVMGDDGAMDYSVHEAWNEATNVYLVVILVSFGLFMYAKRNKRKIMRIFSLPPPA ETLSEPNFYDTISKIRLRQQLEMYSISRKYDYQQPQSQADSVQLSLE
Uniprot No.

Target Background

Database Links
Protein Families
SMIM19 family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What are the optimal storage conditions for preserving protein activity?

For optimal storage of Recombinant Bovine UPF0697 protein C8orf40 homolog, the lyophilized powder should be stored at -20°C to -80°C upon receipt . Working aliquots can be maintained at 4°C for up to one week, but repeated freeze-thaw cycles should be avoided as they may compromise protein integrity and activity .

When reconstituting the protein, it's recommended to:

  • Briefly centrifuge the vial before opening to bring contents to the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (with 50% being optimal) for long-term storage at -20°C/-80°C

  • Aliquot the reconstituted protein to minimize freeze-thaw cycles

The storage buffer typically contains Tris/PBS with 6% trehalose at pH 8.0, which helps maintain protein stability during freeze-thaw cycles . Experimental evidence suggests that maintaining proper storage conditions is crucial for preserving functional activity, as even minor deviations in temperature management can significantly affect protein performance in downstream applications.

How can Design of Experiments (DoE) be applied to optimize the purification protocol?

Design of Experiments (DoE) offers a powerful approach to optimize the purification of Recombinant Bovine UPF0697 protein C8orf40 homolog by systematically evaluating multiple factors simultaneously. When applying DoE to protein purification, researchers should:

  • Identify key factors affecting purification outcomes (temperature, pH, buffer composition, flow rate, etc.)

  • Define critical outputs (yield, purity, activity, nucleic acid contamination)

  • Design factorial experiments to efficiently explore the experimental space

  • Analyze interactions between factors to understand complex relationships

  • Validate optimized conditions with confirmatory experiments

A typical DoE approach for purifying this protein might examine:

FactorLow LevelHigh Level
Temperature4°C25°C
Buffer pH7.08.5
Imidazole concentration20 mM50 mM
Flow rate0.5 mL/min2 mL/min

When implementing DoE for this protein, it's essential to recognize that biological systems can present unexpected complexities. For example, conditions that maximize yield and purity might simultaneously compromise activity or increase nucleic acid contamination . In one study, higher temperatures were found to completely destroy protein activity despite improving other metrics, necessitating operational compromises .

How should researchers address unexpected results or data contradictions?

When facing unexpected results or data contradictions while working with Recombinant Bovine UPF0697 protein C8orf40 homolog, researchers should follow a structured approach:

  • Thoroughly examine the data to identify specific discrepancies from expected outcomes

  • Evaluate initial assumptions and experimental design for potential flaws

  • Consider alternative explanations for the contradictory data

  • Modify data collection processes if methodological issues are identified

  • Refine variables and implement additional controls to test new hypotheses

For example, if protein activity is unexpectedly low despite high purity, consider:

  • Examining whether purification conditions (temperature, pH, salt concentration) are affecting protein folding

  • Investigating if the expression system is introducing post-translational modifications

  • Testing whether the His-tag is interfering with the active site

  • Evaluating if the protein is forming aggregates during purification

It's important to approach contradictory data with an open mind, as unexpected findings can lead to new discoveries. In one documented case, researchers discovered that volume scaling affected protein activity, with larger volumes maintaining activity while smaller volumes used in DoE studies resulted in activity loss at higher temperatures .

What factors most significantly impact expression yield and protein activity?

Several critical factors influence the expression yield and activity of Recombinant Bovine UPF0697 protein C8orf40 homolog:

Based on experimental evidence, temperature appears to have the most dramatic effect on protein activity. In one study, higher temperatures completely destroyed protein activity despite improving yield metrics . This suggests that for this specific protein, lower temperature expression conditions may be critical for maintaining functional integrity, even if total yield is compromised.

A multifactorial optimization might include:

FactorSettingEffect on YieldEffect on Activity
Temperature18°CModerateHigh
Temperature37°CHighLow/None
IPTG0.1 mMLowHigh
IPTG1.0 mMHighModerate
Induction timeEarly logLowVariable
Induction timeMid logModerateHigh

This data indicates researchers must carefully balance yield and activity requirements when designing expression protocols.

What purification strategy is most effective for obtaining high-purity protein?

For Recombinant Bovine UPF0697 protein C8orf40 homolog, a multi-step purification strategy typically yields the best results:

  • Initial Capture: Immobilized Metal Affinity Chromatography (IMAC) using the N-terminal His-tag with a Ni-NTA resin is the primary purification step .

  • Intermediate Purification: Ion exchange chromatography can further remove contaminants based on charge differences between the target protein and impurities.

  • Polishing: While size exclusion chromatography can provide high purity, it may not be ideal for scaling up production . Alternative polishing methods like hydrophobic interaction chromatography might be considered for scale-up scenarios.

When optimizing the IMAC step, consider:

  • Using gradient elution with imidazole (20-300 mM) rather than step elution

  • Including low concentrations of detergents (0.1% Triton X-100 or 0.05% DDM) to maintain membrane protein solubility

  • Adding glycerol (5-10%) to stabilize the protein during purification

  • Maintaining low temperature (4°C) throughout the process to preserve activity

For DoE optimization of the purification process, researchers should focus on balancing multiple quality attributes simultaneously. Data from similar projects indicates that conditions optimizing yield and purity may significantly reduce activity or increase nucleic acid contamination . Therefore, comprehensive characterization of intermediate fractions is essential to define the optimal operating space.

How can researchers verify protein identity and structural integrity?

Verification of protein identity and structural integrity for Recombinant Bovine UPF0697 protein C8orf40 homolog should employ multiple orthogonal techniques:

  • Primary Structure Confirmation:

    • Mass spectrometry (MS) for accurate molecular weight determination

    • Peptide mapping with liquid chromatography-tandem mass spectrometry (LC-MS/MS)

    • N-terminal sequencing to confirm the first 5-10 amino acids

  • Secondary and Tertiary Structure Assessment:

    • Circular dichroism (CD) spectroscopy to evaluate secondary structure elements

    • Fluorescence spectroscopy to assess tertiary folding

    • Dynamic light scattering (DLS) to evaluate homogeneity and detect aggregation

  • Functional Verification:

    • Activity assays specific to the protein's known or predicted function

    • Binding assays if interaction partners are known

    • Stability studies under various conditions to evaluate structural robustness

For this specific protein, SDS-PAGE analysis typically shows >90% purity when properly purified . When analyzing SDS-PAGE results, researchers should be aware that membrane proteins can exhibit anomalous migration patterns.

Additionally, because UPF0697 protein C8orf40 homolog is a membrane protein with potential transmembrane regions, specialized techniques for membrane protein analysis may be necessary, such as:

  • Blue native PAGE to assess oligomeric state

  • Microscale thermophoresis for binding studies

  • Detergent screening to identify optimal solubilization conditions

How should researchers address protein insolubility issues?

Protein insolubility is a common challenge when working with membrane proteins like UPF0697 protein C8orf40 homolog. To address this issue:

  • Optimize Expression Conditions:

    • Reduce expression temperature to 16-18°C

    • Lower inducer concentration (0.1-0.2 mM IPTG)

    • Use specialized E. coli strains designed for membrane protein expression (C41, C43, or Lemo21)

  • Improve Extraction and Solubilization:

    • Screen multiple detergents (DDM, LDAO, OG, CHAPS) at different concentrations

    • Test mixed micelle systems with lipid additives

    • Consider using amphipols or nanodiscs for downstream applications

  • Modify the Construct:

    • Remove flexible regions that might promote aggregation

    • Consider fusion partners known to enhance solubility (MBP, SUMO, Fh8)

    • Explore different tag positions (N-terminal vs. C-terminal)

When facing insolubility issues, systematic detergent screening is particularly valuable. A typical screening approach might include:

Detergent ClassExamplesWorking ConcentrationBest For
MaltosidesDDM, UDM1-2× CMCGeneral purpose, good starting point
GlucosidesOG, NG2-3× CMCStringent extraction
ZwitterionicLDAO, FC-122-5× CMCHigher extraction efficiency
NonionicTriton X-100, C12E81-2× CMCMilder extraction

Experimental evidence suggests that protein activity is highly sensitive to extraction conditions, particularly temperature . Therefore, maintaining low temperatures during cell lysis and protein extraction is critical for preserving functional integrity.

How can researchers optimize expression conditions when facing contradictory requirements?

When optimizing expression conditions for Recombinant Bovine UPF0697 protein C8orf40 homolog, researchers often face contradictory requirements between yield, purity, and activity. To navigate these challenges:

  • Establish a Hierarchical Quality Attribute Ranking:

    • Determine which properties are most critical for your specific application

    • For functional studies, prioritize activity over yield

    • For structural studies, balance yield and purity

  • Implement Multi-objective Optimization:

    • Use DoE approaches that can balance multiple output parameters

    • Create contour plots or response surface models to identify "sweet spots"

    • Develop composite desirability functions that weight different attributes

  • Consider a Two-stage Expression Strategy:

    • First stage: Grow cells at higher temperature (37°C) to maximize biomass

    • Second stage: Reduce temperature (16-18°C) before induction to favor proper folding

Real-world examples have shown that temperature conditions that maximize yield and purity for this protein can completely destroy activity . In one documented case, researchers had to compromise yield to maintain both activity and low nucleic acid contamination.

A typical compromise strategy might look like:

ParameterHigh Yield SettingHigh Activity SettingCompromise Setting
Temperature37°C16°C22°C
IPTG1.0 mM0.1 mM0.3 mM
Induction OD6001.00.60.8
Post-induction time16 h6 h8 h

This compromise approach acknowledges that biological systems rarely have single optimal conditions and instead require balanced solutions that satisfy multiple criteria simultaneously.

What are the most promising applications for Recombinant Bovine UPF0697 protein C8orf40 homolog in current research?

Recombinant Bovine UPF0697 protein C8orf40 homolog (SMIM19) represents an intriguing research target, particularly given its classification as a small integral membrane protein. Current and future research directions include:

  • Functional Characterization: As a protein with unclear function, determining its role in cellular processes remains a key research priority. Knockout studies, interaction partner identification, and localization studies are valuable approaches.

  • Structural Biology: Obtaining high-resolution structural information through X-ray crystallography or cryo-electron microscopy could provide insights into function and evolutionary relationships.

  • Comparative Studies: Examining differences between human and bovine homologs may provide insights into species-specific functions and evolutionary conservation patterns.

  • Development of Research Tools: Creating well-characterized antibodies and assay systems specific to this protein would accelerate research across multiple fields.

  • Integration with Genomic Data: Correlating genetic variations in this gene with phenotypic data from large-scale studies could reveal previously unknown functions or disease associations.

When designing studies involving this protein, researchers should be particularly mindful of the challenges associated with membrane proteins, especially regarding maintaining protein activity during purification and analysis. The documented sensitivity to experimental conditions suggests careful optimization is required for meaningful functional studies .

How should researchers approach experimental design when working with poorly characterized proteins?

When working with poorly characterized proteins like UPF0697 protein C8orf40 homolog, researchers should adopt a systematic approach:

  • Start with Bioinformatic Analysis:

    • Perform sequence alignments and phylogenetic analysis to identify conserved domains

    • Use structural prediction tools to guide experimental design

    • Identify potential post-translational modifications and functional motifs

  • Implement Iterative Experimental Design:

    • Begin with small-scale exploratory experiments before optimization

    • Use DoE approaches to efficiently explore experimental space

    • Be prepared to revise hypotheses based on unexpected results

  • Embrace Multi-method Validation:

    • Use orthogonal techniques to confirm observations

    • Incorporate both in vitro and cellular assays when possible

    • Consider heterologous expression in multiple systems

  • Document Contradictory Results Thoroughly:

    • Maintain detailed records of unexpected outcomes

    • Analyze discrepancies as potential insights rather than experimental failures

    • Consider that contradictions often lead to new discoveries

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.