Recombinant Bovine Uroplakin-1b (UPK1B)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please specify them during order placement. We will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, serving as a reference for your use.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize the development of that tag.
Synonyms
UPK1B; Uroplakin-1b; UP1b; Uroplakin Ib; UPIb
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-260
Protein Length
Full Length of Mature Protein
Species
Bos taurus (Bovine)
Target Names
UPK1B
Target Protein Sequence
AKDDSTVRCFQGLLIFGNVIIGMCSIALMAECIFFVSDQNSLYPLLEATNNDDIYAAAWI GMFVGICLFCLSVLGIVGIMKSNRKILLVYFILMFIVYAFEVASCITAATQRDFFTPNLF LKQMLERYQNNSPPNNDDQWKNNGVTKTWDRLMLQDNCCGVNGPSDWQKYTSAFRTENSD ADYPWPRQCCVMNSLKEPLNLDACKLGVPGYYHSQGCYELISGPMNRHAWGVAWFGFAIL CWTFWVLLGTMFYWSRIDY
Uniprot No.

Target Background

Function
Uroplakin-1b (UPK1B) is a component of the asymmetric unit membrane (AUM), a specialized biomembrane elaborated by terminally differentiated urothelial cells. It may play a significant role in normal bladder epithelial physiology, potentially regulating membrane permeability of superficial umbrella cells or stabilizing the apical membrane through AUM/cytoskeletal interactions.
Database Links

KEGG: bta:282113

STRING: 9913.ENSBTAP00000011866

UniGene: Bt.4089

Protein Families
Tetraspanin (TM4SF) family
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Bladder epithelium.

Q&A

What is Uroplakin-1b and what is its primary function in normal tissue?

Uroplakin-1b (UPK1B) is a transmembrane protein expressed in developing and mature urothelium where it establishes plaques associated with the permeability barrier. It is a critical component of the asymmetric unit membrane (AUM) that forms the specialized apical surface of umbrella cells in the urothelium. UPK1B is essential for normal urinary tract development and function, playing a crucial role in establishing the impermeability of the urothelium to protect underlying tissues from toxic components of urine . In differentiated urothelium, UPK1B serves as a marker of terminal urothelial differentiation, particularly in umbrella cells, alongside other uroplakins like UPK2, UPK3A, and keratin 20 (KRT20) .

How is UPK1B expression regulated during normal development?

UPK1B expression is developmentally regulated during urinary tract formation. Studies using UPK1B-directed RFP expression in mouse models have validated its presence in both developing and mature urothelium. The expression pattern correlates with the differentiation status of the urothelium, with higher expression observed in more differentiated cells. Disruption of UPK1B expression results in altered urothelial organization and cellular composition, suggesting that proper UPK1B expression is necessary for normal urothelial development and differentiation . This developmental regulation appears to be tissue-specific, with distinct expression patterns observed in kidney and bladder urothelium.

What are the structural characteristics of recombinant UPK1B protein?

Recombinant UPK1B protein consists of the full amino acid sequence of bovine Uroplakin-1b, typically produced in expression systems like E. coli or mammalian cells. The protein contains transmembrane domains that facilitate its integration into the cell membrane and regions that participate in the formation of the characteristic plaques in urothelial cells. The recombinant form maintains the structural integrity required for experimental applications while allowing for modifications such as epitope tags for detection or purification. When properly folded, recombinant UPK1B can interact with other uroplakins to form heterodimers, mimicking its native configuration in urothelial plaques .

How can recombinant UPK1B be utilized in bladder cancer research?

Recombinant UPK1B serves as a valuable tool in bladder cancer research for multiple applications. Researchers can use it to develop antibodies for immunohistochemical studies to evaluate UPK1B expression patterns in patient samples, which correlates with clinical parameters including tumor stage, lymph node metastasis, and distant metastasis . The recombinant protein can be employed in protein-protein interaction studies to identify binding partners involved in cancer progression. Additionally, it can serve as a positive control in expression studies examining UPK1B upregulation in cancer tissues compared to normal tissues. In functional studies, recombinant UPK1B can be used to rescue phenotypes in UPK1B-knockdown cells, helping elucidate its specific roles in cancer cell proliferation, invasion, and metastasis .

What experimental models are most suitable for studying UPK1B function?

Multiple experimental models have proven effective for studying UPK1B function. In vitro models include bladder cancer cell lines such as EJ and T-24, which express high levels of UPK1B and are amenable to genetic manipulation through techniques like RNA interference . Primary urothelial cell cultures from normal and diseased tissues provide another valuable model for comparative studies. In vivo, genetically modified mouse models such as UPK1B knockout mice (UPK1B RFP/RFP) have been instrumental in understanding the developmental roles of UPK1B in the urinary tract . These mice exhibit altered urothelial organization, increased proliferation, and congenital anomalies of the kidney and urinary tract (CAKUT), making them excellent models for studying both developmental and pathological processes. Xenograft models using UPK1B-manipulated cancer cells can help evaluate the protein's role in tumor growth and metastasis in a more physiologically relevant context.

How does UPK1B expression differ between normal urothelium and bladder cancer tissues?

Quantitative analysis has revealed significant differences in UPK1B expression between normal urothelium and bladder cancer tissues. Research using qRT-PCR on 92 pairs of bladder cancer tissues and adjacent normal tissues demonstrated that UPK1B is significantly upregulated in cancer tissues compared to normal tissues . This upregulation was also observed in bladder cancer cell lines (EJ, T-24, 253j, and J82) compared to normal human urothelial cells (SV-HUC-1) . The differential expression suggests that UPK1B may serve as a potential biomarker for bladder cancer detection and prognosis. Higher UPK1B expression in bladder cancer correlates with higher tumor stage, lymph node metastasis, and distant metastasis, indicating its potential value as a prognostic indicator .

What are the optimal conditions for expressing and purifying recombinant UPK1B?

For optimal expression and purification of recombinant UPK1B, researchers should consider the following methodological approach:

What techniques are most effective for detecting UPK1B expression in tissue samples?

Several complementary techniques have proven effective for detecting UPK1B expression in tissue samples:

  • Quantitative Real-Time PCR (qRT-PCR): This technique provides sensitive quantification of UPK1B mRNA expression using specific primers (e.g., F: 5'-CCAAAGACAACTCAACTGTTCGT-3', R: 5'-AATGCCGCAACAACCAATAATC-3') . It allows for precise comparison between different tissue types and conditions.

  • Immunohistochemistry (IHC): IHC enables visualization of UPK1B protein expression and localization within tissue architecture. This technique is particularly valuable for examining UPK1B expression patterns in relation to cellular differentiation and tumor progression.

  • Western Blotting: For quantitative protein assessment, Western blotting provides information about UPK1B protein levels and can detect potential post-translational modifications.

  • Fluorescence In Situ Hybridization (FISH): FISH can be used to detect UPK1B gene amplification, which may occur in some cancer cases.

  • Single-Cell RNA Sequencing: For heterogeneous tissues, this advanced technique allows examination of UPK1B expression at the individual cell level, enabling identification of specific cell populations with altered expression.

For comprehensive analysis, combining multiple techniques is recommended to correlate mRNA expression, protein levels, and cellular localization of UPK1B in experimental and clinical samples .

What are the best methods for studying UPK1B-mediated signaling pathways?

To effectively study UPK1B-mediated signaling pathways, researchers should implement a multi-faceted approach:

  • Genetic Manipulation Strategies:

    • RNA interference using validated siRNA sequences targeting UPK1B

    • CRISPR-Cas9 genome editing for complete knockout or targeted mutations

    • Overexpression studies using wild-type and mutant UPK1B constructs

  • Protein Interaction Analysis:

    • Co-immunoprecipitation to identify UPK1B binding partners

    • Proximity ligation assays to visualize protein interactions in situ

    • Mass spectrometry-based proteomics to comprehensively map the UPK1B interactome

  • Signaling Pathway Analysis:

    • Western blotting to assess activation of downstream effectors (e.g., β-catenin, c-myc, cyclinD1 in the Wnt/β-catenin pathway)

    • Phosphoprotein array analysis to identify altered phosphorylation events

    • Luciferase reporter assays to quantify pathway activation

  • Functional Rescue Experiments:

    • Pathway inhibitor/activator studies to confirm signaling dependencies

    • Genetic rescue experiments with wild-type UPK1B in knockout models

    • Selective pathway component manipulation to establish causality

Research has demonstrated that UPK1B influences the Wnt/β-catenin signaling pathway in bladder cancer, with knockdown of UPK1B significantly decreasing the expression of key pathway components including β-catenin, c-myc, and cyclinD1 . This methodological framework allows for comprehensive elucidation of UPK1B's role in cellular signaling networks.

How does UPK1B dysfunction contribute to congenital anomalies of the kidney and urinary tract?

UPK1B dysfunction significantly impacts urinary tract development, with several key mechanisms contributing to congenital anomalies of the kidney and urinary tract (CAKUT):

  • Disruption of Urothelial Barrier Formation: UPK1B is essential for establishing the asymmetric unit membrane (AUM) that forms the permeability barrier in urothelium. When UPK1B is absent or dysfunctional, the formation of urothelial plaques is impaired, leading to compromised barrier function. This exposes underlying tissues to toxic components of urine, causing cellular damage, especially in umbrella cells .

  • Altered Tissue Differentiation: In UPK1B-deficient models (UPK1B RFP/RFP mice), the urothelium exhibits significant alterations in cellular composition and organization. There is abnormal expression of markers for different urothelial cell types, including umbrella cells (Krt20), intermediate cells (Krt13), and basal cells (Krt5, Krt14) . This dysregulation results in less mature urothelium with multilayered renal urothelium that appears bladder-like and a highly disorganized bladder urothelium that is dysplastic.

  • Increased Proliferation: UPK1B-deficient bladder urothelium shows a 5-fold increase in proliferation, primarily associated with basal cells but also some intermediate cells . This hyperproliferation disrupts the normal developmental processes and tissue architecture.

  • Developmental Signaling Disruption: UPK1B deficiency alters critical developmental signaling pathways necessary for proper kidney and urinary tract formation. This can lead to structural abnormalities such as the unilateral duplex kidneys observed in UPK1B-deficient mice .

These mechanisms collectively demonstrate UPK1B's crucial role in urinary tract development, with its dysfunction mechanistically linked to CAKUT through alterations in barrier formation, cellular differentiation, proliferation, and developmental signaling.

What is the prognostic significance of UPK1B expression levels in bladder cancer?

UPK1B expression levels have significant prognostic implications in bladder cancer, as demonstrated by comprehensive clinical studies. Analysis of 92 pairs of bladder cancer tissues revealed that UPK1B expression is significantly upregulated in cancer tissues compared to adjacent normal tissues . This expression pattern correlates with several key clinical parameters:

These clinical correlations are supported by functional studies showing that UPK1B promotes cancer cell proliferation, invasion, and migration . The prognostic value of UPK1B expression remains significant even when accounting for other clinical variables, suggesting it could serve as an independent prognostic biomarker. These findings indicate that UPK1B expression assessment could potentially be incorporated into clinical risk stratification systems to improve treatment decision-making for bladder cancer patients.

How does UPK1B knockdown affect bladder cancer cell behavior in experimental models?

Experimental knockdown of UPK1B in bladder cancer cells produces multiple significant phenotypic changes that provide insight into its role in cancer progression:

  • Decreased Cell Proliferation: When UPK1B is silenced using small interfering RNA (si-UPK1B) in bladder cancer cell lines (EJ and T-24), cell proliferation is significantly reduced compared to control cells (si-NC), as measured by both CCK-8 assay and colony formation assay . This indicates that UPK1B normally promotes cancer cell proliferation.

  • Inhibited Cell Migration: Transwell assay results demonstrate that UPK1B knockdown significantly reduces the migratory capacity of bladder cancer cells. The number of migrated cells is markedly lower in si-UPK1B-transfected cells compared to control cells .

  • Reduced Invasive Potential: Similar to migration, the invasive ability of bladder cancer cells is substantially diminished following UPK1B knockdown, as evidenced by decreased invasion through Matrigel-coated transwell membranes .

  • Altered Signaling Pathway Activation: At the molecular level, UPK1B knockdown leads to downregulation of key components in the Wnt/β-catenin signaling pathway. Western blot analysis shows significantly decreased expression of β-catenin, c-myc, and cyclinD1 in si-UPK1B-transfected cells compared to controls .

  • Pathway Dependency: Rescue experiments have demonstrated that UPK1B acts through β-catenin to exert its effects on cancer cell behavior, as β-catenin overexpression can partially rescue the phenotypes induced by UPK1B knockdown .

These experimental findings provide strong evidence that UPK1B promotes the malignant phenotype of bladder cancer cells through multiple mechanisms, particularly by activating the Wnt/β-catenin signaling pathway, and suggest that targeting UPK1B might represent a potential therapeutic strategy for bladder cancer.

What signaling pathways are regulated by UPK1B in normal and cancer cells?

Research has identified several signaling pathways regulated by UPK1B in both normal and cancer contexts:

  • Wnt/β-catenin Signaling Pathway: In bladder cancer, UPK1B positively regulates the Wnt/β-catenin pathway, which is crucial for cell proliferation and oncogenesis. Knockdown of UPK1B significantly decreases the expression of key proteins in this pathway, including β-catenin, c-myc, and cyclinD1 . This regulatory relationship appears bidirectional, as rescue experiments indicate that UPK1B is also regulated by β-catenin, suggesting a potential feedback loop.

  • Cell Differentiation Pathways: In normal development, UPK1B influences pathways controlling urothelial differentiation. Its expression is associated with terminal urothelial differentiation markers, and its disruption leads to altered expression of cellular markers including Krt20, Krt13, Krt5, and Krt14 . This suggests involvement in signaling networks that maintain urothelial integrity and differentiation status.

  • Proliferation Signaling: UPK1B regulates pathways controlling cell proliferation in both development and cancer. In UPK1B-deficient bladder urothelium, there is a 5-fold increase in proliferation, commonly associated with basal cells but also some intermediate cells . Conversely, in cancer cells, UPK1B promotes proliferation through mechanisms that likely include Wnt/β-catenin signaling activation.

  • Epithelial-Mesenchymal Transition (EMT) Pathways: The involvement of UPK1B in cancer cell migration and invasion suggests its potential regulation of EMT-related signaling, which enables cancer cells to acquire motility and invasiveness .

These pathway interactions highlight UPK1B's complex role in cellular signaling networks, with context-dependent functions in normal development versus malignant transformation.

How does UPK1B interact with the Wnt/β-catenin pathway in bladder cancer progression?

UPK1B exhibits a complex and bidirectional relationship with the Wnt/β-catenin pathway in bladder cancer progression:

  • Positive Regulation of Pathway Components: Experimental evidence demonstrates that UPK1B positively regulates key components of the Wnt/β-catenin pathway. In bladder cancer cells, knockdown of UPK1B using small interfering RNA significantly reduces the expression of β-catenin, c-myc, and cyclinD1, which are critical mediators of this pathway . This indicates that UPK1B normally promotes activation of Wnt/β-catenin signaling.

  • Reciprocal Regulation: Rescue experiments have shown that UPK1B is itself regulated by β-catenin, suggesting a feedback loop mechanism . This bidirectional relationship creates a potential amplification circuit that may contribute to sustained pathway activation in cancer cells.

  • Functional Consequences: The UPK1B-mediated activation of the Wnt/β-catenin pathway has direct functional consequences for cancer progression:

    • Enhanced cell proliferation through cyclinD1 and c-myc upregulation

    • Increased cell migration and invasion capabilities

    • Potential influence on cancer stem cell properties, a known function of Wnt/β-catenin signaling

  • Clinical Correlation: The relationship between UPK1B and Wnt/β-catenin signaling has clinical relevance, as both UPK1B expression and β-catenin expression are elevated in bladder cancer tissues compared to normal tissues . This parallel upregulation supports the mechanistic connection observed in experimental models.

The UPK1B-Wnt/β-catenin axis represents a potentially targetable mechanism in bladder cancer, with implications for developing therapeutic strategies that disrupt this oncogenic signaling network.

What protein-protein interactions are critical for UPK1B function in urinary tract development?

Several critical protein-protein interactions mediate UPK1B function during urinary tract development:

  • Uroplakin Family Interactions: UPK1B forms heterodimers with UPK3A, which is essential for the proper assembly of the asymmetric unit membrane (AUM) in urothelial plaques. This interaction is a fundamental step in establishing the permeability barrier that protects underlying tissues from urine. Disruption of this interaction prevents the formation of functional plaques, leading to compromised barrier function .

  • Cytoskeletal Protein Interactions: UPK1B interacts with cytoskeletal proteins, enabling proper localization and anchoring of urothelial plaques at the apical surface of umbrella cells. These interactions are crucial for maintaining the structural integrity of the urothelium and its barrier function.

  • Cell Differentiation Regulators: UPK1B interacts with proteins involved in cell fate determination and differentiation. In UPK1B-deficient models, altered expression of cellular markers such as Krt20, Krt13, Krt5, and Krt14 suggests disrupted interactions with transcriptional regulators and differentiation factors .

  • Developmental Signaling Mediators: UPK1B likely interacts with components of developmental signaling pathways that coordinate kidney and urinary tract morphogenesis. These interactions influence tissue-specific progenitor populations and contribute to the regional differentiation of kidney and bladder urothelium .

  • Stem/Progenitor Cell Regulators: The expansion of p63, a stem/progenitor marker, in UPK1B-deficient urothelium suggests that UPK1B normally interacts with factors that regulate stem cell homeostasis and differentiation in the developing urinary tract .

These protein-protein interactions collectively establish UPK1B as a critical orchestrator of urinary tract development, influencing cellular organization, differentiation, and specialized function of the urothelium.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.