Recombinant Bovine Uroplakin-3a (UPK3A)

Shipped with Ice Packs
In Stock

Description

Functional Roles in Urothelial Biology

UPK3A plays dual roles in maintaining urothelial integrity and preventing bacterial adherence:

Disease Association

  • Bladder Cancer: Loss of UPK3A expression correlates with invasive bladder cancer and poor prognosis .

  • Autoimmune Cystitis: A 20-mer peptide (UPK3A 65–84) induces CD4+ T-cell-mediated interstitial cystitis (IC) in BALB/c mice, mimicking human IC symptoms like urinary frequency and pelvic pain .

Disease Modeling

Recombinant UPK3A is used to study autoimmune bladder diseases. Key findings from murine models:

ParameterControl (CFA)UPK3A 65–84 ImmunizedSource
Micturition FrequencyBaseline↑ (Increased)
Urine Output/MicturitionBaseline↓ (Decreased)
Pelvic PainBaseline↑ (Von Frey filament test)
Cytokine ProfileBaseline↑ IFN-γ, IL-2 (Th1 response)

Diagnostic Biomarker

UPK3A serves as a specific marker for urothelial carcinomas:

  • Sensitivity/Specificity: Detects 60% of metastatic transitional cell carcinomas without cross-reactivity with non-urothelial tumors .

  • Clinical Utility: Loss of UPK3A expression predicts invasive bladder cancer and upper tract urothelial carcinoma progression .

Experimental Tools and Antibodies

Recombinant UPK3A is paired with specialized antibodies for detection:

Antibody TypeApplicationsReactivitySource
Mouse Monoclonal (AU1)IHC, WBBovine, Human, Pig, Rat
Rabbit Polyclonal (PAb)WB, ELISAHuman, Bovine
Recombinant Rabbit (83499-3-RR)WB, ELISAHuman

Challenges and Future Directions

While recombinant UPK3A advances disease modeling and diagnostics, challenges remain:

  • Glycosylation Limitations: E. coli-produced UPK3A lacks glycosylation, potentially altering functional interactions .

  • Therapeutic Potential: Further studies are needed to explore UPK3A-based therapies for IC/PBS or bladder cancer.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us for preferential development.
Synonyms
UPK3A; UPK3; Uroplakin-3a; UP3a; Uroplakin III; UPIII
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
19-287
Protein Length
Full Length of Mature Protein
Species
Bos taurus (Bovine)
Target Names
UPK3A
Target Protein Sequence
VNLQPQLASVTFATNNPTLTTVALEKPLCMFDSSAALHGTYEVYLYVLVDSASFRNASVQDSTKTPLSSTFQQTQGGRTGPYKAAAFDLTPCSDSPSLDAVRDVSRASEILNAYLIRVGTNGTCLLDPNFQGLCNPPLSAATEYRFKYVLVNMSSGLVQDQTLWSDPIRTDRLTLYSAIDTWPGRRSGGMIVITSILGSLPFFLLIGFAGAIVLSLVDRGDADGATSHDSQITQEAVPKSLGTSEPSYTSVNRGPSLDRAEVYASKLQD
Uniprot No.

Target Background

Function

Uroplakin-3a (UPK3A) is a component of the asymmetric unit membrane (AUM), a specialized biomembrane in terminally differentiated urothelial cells. It plays a crucial role in AUM-cytoskeleton interaction and contributes to the formation of the urothelial glycocalyx, which is important in preventing bacterial adhesion.

Database Links
Protein Families
Uroplakin-3 family
Subcellular Location
Endoplasmic reticulum membrane; Single-pass type I membrane protein. Note=Heterodimer formation with UPK1B is a prerequisite to exit out of the endoplasmic reticulum (ER).
Tissue Specificity
Bladder epithelium.

Q&A

What is Uroplakin-3a (UPK3A) and what is its biological significance?

Uroplakin-3a (UPK3A) is a transmembrane protein belonging to the uroplakin-3 family and serves as a critical structural component of the urothelium, which lines the urinary tract. Unlike some uroplakins that cross the lipid bilayer four times (UPIa and UPIb, which are tetraspanins), UPK3A traverses the membrane once, similar to UPII and UPIIIb . UPK3A possesses a large luminal/extracellular domain and, importantly, contains significant cytoplasmic portions in its C-terminus .

Biologically, UPK3A plays essential roles in:

  • Maintaining the integrity and barrier function of the urothelium

  • Formation of specialized membrane domains called urothelial plaques

  • Proper development of the urinary tract

Research with knockout models has demonstrated that UPK3A deletion results in abnormal urothelium lacking a typical umbrella cell layer, with the apical surface covered by unusually small urothelial plaques interspersed by expanded "hinge" areas . These structural abnormalities lead to a leaky urothelium and significant urinary tract defects including vesicoureteral reflux, hydronephrosis, and altered renal function . This underscores UPK3A's importance in both urothelial structure and function throughout the urinary system.

How is recombinant bovine UPK3A typically produced for research applications?

Recombinant bovine UPK3A is typically produced using bacterial expression systems, most commonly E. coli, though the specific methodologies may vary based on research needs. For optimal production, the process generally follows these steps:

  • Gene cloning: The bovine UPK3A gene sequence is cloned into an appropriate expression vector, often incorporating a fusion tag (commonly a His-tag) to facilitate purification .

  • Bacterial transformation: The vector is introduced into an E. coli expression strain optimized for recombinant protein production.

  • Protein expression: Bacterial cultures are grown to appropriate density, and protein expression is induced, typically using IPTG for systems with lac operators.

  • Purification: The recombinant protein is isolated using chromatographic techniques, particularly affinity chromatography targeting the fusion tag. For His-tagged UPK3A, metal chelate chromatography is the standard approach .

  • Quality control: The purified protein undergoes verification for purity (typically >90% by SDS-PAGE) and identity confirmation through Western blot analysis using specific anti-UPK3A antibodies .

The resulting recombinant protein is typically formulated in a stabilizing buffer containing components such as Tris-HCl (pH 8.0), NaCl, DTT and glycerol . For human recombinant UPK3A, which serves as a reference point for bovine production, the standard formulation contains 20mM Tris-HCl buffer (pH 8.0), 150mM NaCl, 2mM DTT, and 20% glycerol at a concentration of approximately 0.25mg/ml . Similar buffer systems would likely be appropriate for bovine UPK3A.

What are the key structural and functional differences between bovine UPK3A and human or mouse homologs?

Bovine UPK3A shares significant homology with its human and mouse counterparts but exhibits several key differences that researchers should consider:

Functional Differences:

  • Plaque formation: While the fundamental role in urothelial plaque formation is conserved, subtle species differences in plaque size and morphology exist. Mouse studies show that UPIII knockout results in smaller urothelial plaques with expanded "hinge" areas , and similar studies with bovine models would likely reveal species-specific characteristics.

  • Partner protein interactions: The interaction between UPK3A and UPIb is critical for proper cellular distribution, with studies in mouse models showing that elimination of UPIII selectively affected expression and targeting of UPIb . These interaction dynamics may differ slightly in bovine systems.

Experimental Implications:
When designing experiments with recombinant bovine UPK3A, researchers should account for these species-specific differences, particularly when:

  • Selecting antibodies for detection (ensuring cross-reactivity)

  • Interpreting functional studies in comparison to human or mouse literature

  • Analyzing protein-protein interactions within urothelial plaques

The antibody recognition profile can serve as a useful reference point, with certain monoclonal antibodies like AU1 having confirmed reactivity across bovine, human, pig and rat species , suggesting conservation of key epitopes.

How do you verify the purity and activity of recombinant bovine UPK3A preparations?

Verifying the purity and activity of recombinant bovine UPK3A requires multiple analytical and functional approaches:

Purity Assessment Methods:

  • SDS-PAGE Analysis: Standard for determining protein purity, with high-quality preparations typically showing >90% purity . Visualization is achieved through Coomassie blue staining or silver staining for higher sensitivity.

  • Western Blot Analysis: Confirms identity using specific anti-UPK3A antibodies. Western blot protocols for UPK3A typically involve:

    • Transfer to PVDF membrane

    • Blocking with 5% dry milk in PBST

    • Incubation with primary antibody (e.g., anti-Uroplakin III mouse monoclonal, AU1) at approximately 0.05 μg/ml

    • Detection with appropriate secondary antibody (e.g., goat anti-mouse HRP at 0.2 μg/ml)

    • Visualization using chemiluminescent detection systems

  • Mass Spectrometry: Provides definitive confirmation of protein identity and can detect potential post-translational modifications or truncations.

Activity and Functionality Verification:

  • Binding Assays: Assess the ability of recombinant UPK3A to interact with its known partner proteins, particularly UPIb. Co-immunoprecipitation experiments can validate these interactions.

  • Structural Integrity Testing: Circular dichroism spectroscopy can confirm proper protein folding by analyzing secondary structure content.

  • Membrane Integration Assays: For full functional assessment, recombinant UPK3A can be incorporated into artificial membrane systems to evaluate its membrane integration properties.

  • Species Specificity Testing: Cross-reactivity with antibodies known to detect bovine UPK3A (such as AU1 monoclonal antibody) confirms the proper epitope presentation.

Quality Control Data Documentation:
For each batch of recombinant bovine UPK3A, a quality control data sheet should document:

  • Protein concentration (typically 0.25mg/ml for comparable preparations)

  • Purity percentage by SDS-PAGE

  • Western blot confirmation results

  • Buffer composition and storage conditions

  • Batch-specific activity measurements

  • Freeze-thaw stability data

This comprehensive quality control ensures experimental reproducibility and reliable research outcomes when working with recombinant bovine UPK3A.

How can recombinant bovine UPK3A be used to study urothelial plaque formation and membrane dynamics?

Recombinant bovine UPK3A serves as a powerful tool for investigating the complex processes of urothelial plaque formation and membrane dynamics through several sophisticated experimental approaches:

In vitro Reconstitution Systems:

  • Liposome Incorporation: Purified recombinant UPK3A can be integrated into artificial lipid bilayers to study its membrane organization properties. By combining UPK3A with its partner proteins (particularly UPIb), researchers can analyze the minimal requirements for plaque-like structure formation.

  • Atomic Force Microscopy (AFM): This technique allows visualization of UPK3A-containing membrane domains at nanometer resolution, providing insights into how these proteins organize within membranes. Studies in knockout mice revealed that UPK3A absence results in unusually small urothelial plaques , suggesting its critical role in determining plaque dimensions.

Cellular Models:

  • Transfection Studies: Non-urothelial cell lines transfected with recombinant bovine UPK3A (along with other uroplakins) can reveal the hierarchy and requirements for plaque assembly. This approach helps distinguish intrinsic assembly properties from tissue-specific factors.

  • FRAP Analysis: Fluorescently-tagged recombinant UPK3A can be used in Fluorescence Recovery After Photobleaching experiments to measure protein mobility within membranes, providing insights into the dynamics of plaque formation and stability.

Protein Interaction Mapping:

  • Cross-linking Experiments: Chemical cross-linking of recombinant UPK3A with potential binding partners followed by mass spectrometry analysis can identify interaction interfaces critical for plaque assembly.

  • Partner Protein Dependency: Research has shown that eliminating UPK3A selectively affects the expression and targeting of its presumed partner UPIb . Using recombinant protein to rescue this phenotype can elucidate the molecular basis of this dependency.

Structural Analysis:

  • Cryo-EM Studies: Purified recombinant UPK3A, alone or in complex with partner proteins, can be analyzed by cryo-electron microscopy to determine structural arrangements within urothelial plaques at near-atomic resolution.

  • Membrane Domain Reconstruction: By combining recombinant UPK3A with specific lipids, researchers can study how these proteins influence membrane curvature and rigidity, properties that are important for the specialized function of the urothelium as a permeability barrier.

What experimental approaches can determine interactions between bovine UPK3A and other uroplakins?

Investigating interactions between bovine UPK3A and other uroplakins requires multiple complementary approaches to fully characterize these complex relationships:

Biochemical Interaction Assays:

  • Co-immunoprecipitation (Co-IP):

    • Experimental Design: Anti-UPK3A antibodies (such as AU1 monoclonal) can pull down UPK3A and its interacting partners from urothelial lysates or reconstituted systems.

    • Data Analysis: Western blotting of the precipitates with antibodies against other uroplakins (particularly UPIb, its presumed partner) quantifies interaction strength.

    • Expected Results: Based on mouse studies, UPK3A should strongly co-precipitate with UPIb, as elimination of UPIII selectively affected UPIb expression and targeting .

  • Surface Plasmon Resonance (SPR):

    • Methodology: Recombinant bovine UPK3A is immobilized on a sensor chip, and purified uroplakins are flowed over the surface.

    • Quantitative Metrics: Association (ka) and dissociation (kd) rate constants and equilibrium dissociation constants (KD) provide precise measurements of binding affinities.

  • Proximity Labeling:

    • Implementation: UPK3A fused with enzymes like BioID or APEX2 can biotinylate proximal proteins when expressed in cellular systems.

    • Advantage: Captures transient or weak interactions that might be missed by co-IP approaches.

Structural Approaches:

  • Crosslinking Mass Spectrometry (XL-MS):

    • Protocol: Chemical crosslinkers stabilize protein-protein interactions before mass spectrometric analysis.

    • Output: Identification of specific residues involved in UPK3A-uroplakin interfaces.

  • Förster Resonance Energy Transfer (FRET):

    • Setup: Fluorescently labeled UPK3A and partner uroplakins are monitored for energy transfer when in close proximity.

    • Application: Particularly valuable for analyzing interactions in living cells or membrane systems.

Functional Impact Assessment:

  • Mutagenesis Studies:

    • Design: Targeted mutations in recombinant bovine UPK3A's interaction domains followed by binding assays.

    • Reference Point: In knockout mice, UPK3A ablation led to defective glycosylation and abnormal targeting of uroplakin Ib , suggesting specific interaction domains.

  • Heterologous Expression Systems:

    • Approach: Co-expression of UPK3A with individual uroplakins in non-urothelial cells.

    • Analysis: Subcellular localization studies through immunofluorescence microscopy reveal co-dependence for proper targeting.

Data Comparison Table for UPK3A Interactions:

Interacting ProteinDetection MethodBinding Affinity RangeFunctional Consequence of Disruption
UPIbCo-IP, FRETHigh affinity (predicted KD <100nM)Abnormal glycosylation and targeting of UPIb
UPIaSPR, XL-MSModerate affinity (predicted)Indirect effects via UPIb partnership
UPIIProximity labelingLow-moderate (predicted)Potential plaque organization defects

These methodologies, particularly when used in combination, provide comprehensive characterization of the interaction landscape of bovine UPK3A within the complex milieu of uroplakin proteins and urothelial plaques.

How does recombinant bovine UPK3A compare with native UPK3A in structural and functional assays?

The comparison between recombinant bovine UPK3A and native UPK3A reveals important differences that researchers must consider when designing experiments and interpreting results:

Structural Comparisons:

  • Post-translational Modifications (PTMs):

    • Native UPK3A: Contains complete glycosylation patterns and other PTMs specific to bovine urothelium.

    • Recombinant UPK3A: When produced in E. coli systems, lacks eukaryotic PTMs entirely . Alternative expression in insect or mammalian cells provides closer, but not identical, PTM patterns.

    • Significance: Glycosylation affects protein folding, stability, and recognition by binding partners. Studies in mice showed that UPK3A ablation led to defective glycosylation of UPIb , suggesting glycosylation is crucial for uroplakin complex formation.

  • Protein Folding and Conformation:

    • Native UPK3A: Has native conformation stabilized by cellular chaperones during synthesis.

    • Recombinant UPK3A: May exhibit subtle conformational differences, particularly in the extracellular domain, due to different folding environments during expression.

    • Detection Method: Circular dichroism spectroscopy can quantify these conformational differences.

  • Membrane Integration:

    • Native UPK3A: Properly inserted into the membrane during cellular translation.

    • Recombinant UPK3A: Requires refolding and artificial incorporation into membrane systems.

Functional Comparisons:

  • Partner Protein Binding:

    PropertyNative UPK3ARecombinant UPK3ADetection Method
    UPIb Binding AffinityHigh (KD typically <50nM)Moderate-high (dependent on proper refolding)SPR, ELISA
    Binding KineticsRapid associationGenerally slower associationReal-time binding assays
    Complex StabilityHighly stable complexesVariable stabilityThermal shift assays
  • Antibody Recognition:

    • Both forms are typically recognized by monoclonal antibodies like AU1 , but epitope accessibility may differ.

    • Western blot analysis shows recombinant UPK3A is detectable with standard antibodies, but may require optimization of conditions .

  • Plaque Formation Capacity:

    • Native UPK3A: Participates effectively in the formation of urothelial plaques.

    • Recombinant UPK3A: May require specific conditions to participate in plaque-like structures in vitro.

    • Assessment: Electron microscopy of reconstituted systems can evaluate structural differences in resulting complexes.

Experimental Considerations:

  • Expression System Selection:

    • For structural studies: E. coli-expressed UPK3A may be sufficient .

    • For functional/interaction studies: Expression in mammalian cells provides more native-like properties.

  • Validation Approach:

    • Critical control: Compare experimental results between recombinant and native sources when possible.

    • Native preparation: Isolation from bovine bladder tissue provides the gold standard for comparison.

  • Complementation Experiments:

    • Testing whether recombinant UPK3A can rescue defects in UPK3A-knockout systems provides functional validation.

    • Reference point: Studies in knockout mice showed that UPK3A absence led to abnormal urothelium with small plaques and expanded hinge regions .

What are the critical parameters for using recombinant bovine UPK3A in membrane reconstitution experiments?

Successful membrane reconstitution experiments with recombinant bovine UPK3A require meticulous attention to multiple parameters that can significantly impact experimental outcomes:

Protein Preparation Factors:

  • Purity Requirements:

    • Minimum purity: >90% by SDS-PAGE is essential to prevent interference from contaminants.

    • Aggregation assessment: Dynamic light scattering should confirm monodispersity before reconstitution.

    • Endotoxin levels: For cell-based assays, endotoxin removal is critical (target <0.1 EU/μg protein).

  • Buffer Composition:

    • Optimal starting buffer: 20mM Tris-HCl (pH 8.0), 150mM NaCl, 2mM DTT, and 20% glycerol .

    • Detergent selection: Mild non-ionic detergents (e.g., n-dodecyl-β-D-maltoside) preserve protein structure while solubilizing membranes.

    • Transition considerations: Buffer exchange protocols must maintain protein stability throughout the reconstitution process.

Membrane System Parameters:

  • Lipid Composition:

    • Basic formulation: Phosphatidylcholine (PC) and phosphatidylethanolamine (PE) form the foundation (typically 70:30 ratio).

    • Critical additions: Cholesterol (10-20 mol%) enhances membrane stability and more closely mimics urothelial membranes.

    • Charge considerations: Including negatively charged lipids (5-10% phosphatidylserine) may improve protein orientation.

  • Protein-to-Lipid Ratio:

    • Starting ratio: 1:100 to 1:200 (w/w) protein:lipid for initial experiments.

    • Optimization range: Titration experiments from 1:50 to 1:500 to determine optimal incorporation.

    • Partner proteins: When co-reconstituting with UPIb (its presumed partner), maintain physiologically relevant stoichiometry based on urothelial expression levels.

  • Reconstitution Technique Selection:

    MethodAdvantagesLimitationsBest Applications
    Detergent DialysisGentle, uniform vesiclesTime-consuming (24-48h)Functional studies requiring intact protein
    Detergent AdsorptionRapid (2-4h)Potential protein aggregationPreliminary screening experiments
    Direct IncorporationSimple protocolLimited efficiencySmall-scale pilot studies
    ExtrusionUniform vesicle sizePotential protein damageExperiments requiring defined vesicle dimensions

Quality Control and Validation:

  • Incorporation Efficiency:

    • Quantification method: Density gradient centrifugation followed by western blotting.

    • Target efficiency: >70% incorporation for meaningful functional studies.

  • Protein Orientation:

    • Assessment technique: Protease protection assays to confirm correct topology.

    • Expected result: C-terminal domain should be protected or exposed depending on reconstitution into liposomes or proteoliposomes.

  • Functional Validation:

    • Partner protein interaction: Confirm UPIb binding capacity using FRET or chemical crosslinking.

    • Structural organization: Electron microscopy to verify formation of plaque-like structures, comparing to native urothelial plaques which are disrupted in UPK3A-knockout mice .

Experimental Conditions Optimization:

  • Temperature Control:

    • Reconstitution temperature: Perform at 4-8°C to maintain protein stability.

    • Storage conditions: Store at 4°C if using within 2-4 weeks, or at -20°C for longer periods .

    • Functional assays: Conduct at physiologically relevant temperatures (37°C for mammalian systems).

  • pH and Ionic Strength:

    • Optimal pH range: 7.2-7.6 for functional studies.

    • Salt concentration: 150mM NaCl standard, but titration from 100-300mM may improve specific applications.

By systematically controlling these parameters, researchers can develop robust reconstitution systems that accurately reflect the behavior of bovine UPK3A in native membranes, providing insights into its role in urothelial plaque formation and function.

What are common challenges in working with recombinant bovine UPK3A and how can they be addressed?

Researchers working with recombinant bovine UPK3A frequently encounter several challenges that can impact experimental outcomes. Here are the most common issues and evidence-based solutions:

Production and Purification Challenges:

  • Low Expression Yields:

    • Problem: UPK3A, as a membrane protein, often expresses poorly in bacterial systems.

    • Solution: Optimize codon usage for E. coli, reduce expression temperature to 16-18°C, and test different E. coli strains (BL21(DE3)pLysS often improves membrane protein yields).

    • Validation: Expression yields can be monitored by Western blot using anti-UPK3A antibodies such as AU1, which reacts with bovine UPK3A .

  • Protein Aggregation:

    • Problem: Recombinant UPK3A tends to form inclusion bodies or aggregates.

    • Solution: Include stabilizing agents (20% glycerol, 2mM DTT) in all buffers, and consider fusion tags like SUMO or thioredoxin that enhance solubility.

    • Assessment: Dynamic light scattering can detect early aggregation, allowing buffer optimization before significant loss.

  • Contamination During Shipping/Storage:

    • Problem: Small volumes of protein may become entrapped in vial seals .

    • Solution: Brief centrifugation of vials before opening recovers entrapped material. Store at 4°C for short-term use (2-4 weeks) or at -20°C with a carrier protein (0.1% HSA or BSA) for long-term storage .

Functional Characterization Challenges:

  • Loss of Partner Protein Binding Activity:

    • Problem: Recombinant UPK3A may lose ability to interact with UPIb, its critical partner.

    • Solution: Verify protein folding using circular dichroism before interaction studies. Studies in knockout mice show that UPK3A elimination affects UPIb expression and targeting , suggesting their interaction is physiologically critical.

    • Experimental approach: Co-immunoprecipitation assays with gradual optimization of detergent conditions often restore binding activity.

  • Non-specific Antibody Cross-reactivity:

    • Problem: Antibodies may cross-react between UPK3A and UPK3B.

    • Solution: Perform specificity tests with recombinant UPK3A and UPK3B proteins. Evidence shows some antibodies like AU1 specifically recognize UPK3A but not UPK3B .

    • Protocol refinement: Optimize antibody concentrations (typically 0.05 μg/ml for primary antibodies in Western blots) and blocking conditions (5% dry milk in PBST has proven effective) .

Analytical Challenges and Solutions:

ChallengeManifestationSolutionValidation Method
Poor detection sensitivityWeak signals in Western blotsEnhance chemiluminescent detection with extended exposure times; use secondary antibody at 0.2 μg/ml Positive control with known UPK3A-expressing samples
Inconsistent quantificationVariable results between experimentsEstablish standard curves with purified recombinant UPK3ACoefficient of variation <15% between technical replicates
Background in binding assaysHigh signal-to-noise ratioIncrease washing steps, optimize detergent concentration in wash buffersCompare to negative controls lacking primary antibody
Membrane incorporation efficiencyLow protein integration in reconstitutionPre-treatment of liposomes with low concentrations of detergent before protein additionDensity gradient separation followed by Western blot quantification

Advanced Troubleshooting Approaches:

  • Epitope Accessibility Issues:

    • Problem: Conformational changes may mask antibody recognition sites.

    • Solution: Try multiple antibodies targeting different epitopes or consider mild denaturation protocols that preserve the epitope while improving accessibility.

    • Reference: Western blot protocols have been optimized for UPK3A detection using 0.05 μg/ml antibody concentration .

  • Species-Specific Differences:

    • Problem: Extrapolating from human or mouse UPK3A studies to bovine systems may introduce inconsistencies.

    • Solution: Always include species-matched controls in comparative studies. Some antibodies like AU1 have confirmed cross-reactivity with bovine, human, pig, and rat UPK3A .

By systematically addressing these challenges with the recommended solutions, researchers can significantly improve experimental outcomes when working with recombinant bovine UPK3A.

How can recombinant bovine UPK3A be used to study urinary tract pathologies and development?

Recombinant bovine UPK3A serves as a valuable research tool for investigating various urinary tract pathologies and developmental processes, offering unique insights through multiple experimental approaches:

Developmental Biology Applications:

  • Urothelial Differentiation Models:

    • Experimental approach: Organ culture systems supplemented with recombinant UPK3A can model epithelial differentiation.

    • Research question: How does UPK3A timing and concentration affect urothelial terminal differentiation?

    • Evidence basis: Studies in knockout mice revealed that UPK3A absence results in abnormal urothelium lacking a typical umbrella cell layer , suggesting its critical role in terminal differentiation.

  • Vesicoureteral Junction Formation:

    • Model systems: Tissue-engineered constructs incorporating recombinant UPK3A.

    • Relevance: UPK3A knockout mice exhibit enlarged ureteral orifices leading to vesicoureteral reflux and hydronephrosis .

    • Investigative goal: Determine if supplementation with recombinant UPK3A can rescue proper junction formation in developmental models.

Pathological Condition Investigations:

  • Urothelial Barrier Function Disorders:

    • Experimental design: Trans-epithelial resistance measurements in cell models with modulated UPK3A expression or exogenous recombinant protein application.

    • Pathological insight: Knockout studies showed that UPK3A-deficient urothelium becomes leaky , suggesting applications for interstitial cystitis and other barrier dysfunction disorders.

  • Bladder Cancer Biomarker Development:

    • Clinical application: UPK3A is recognized as a highly specific marker for urothelial carcinomas .

    • Research approach: Developing bovine models of urothelial carcinoma and testing recombinant UPK3A antibody-based detection systems.

    • Methodology: Immunohistochemical optimization using anti-UPK3A antibodies at calibrated concentrations.

Comparative Disease Models:

Disease ConditionUPK3A RoleExperimental Approach with Recombinant ProteinExpected Outcomes
Renal AdysplasiaAssociated with gene mutations Competition assays with wildtype and mutant recombinant proteinsDifferential binding to developmental signaling partners
Vesicoureteral RefluxStructural abnormalities in UPK3A knockout mice Ex vivo tissue culture with recombinant UPK3A supplementationPotential rescue of proper orifice development
Congenital Bladder DisordersDevelopmental abnormalities in urotheliumOrganoid models supplemented with recombinant UPK3AImproved differentiation of umbrella cell layer

Mechanistic Investigations:

  • Urothelial Plaque Assembly:

    • Molecular approach: In vitro reconstitution systems combining recombinant UPK3A with UPIb and other uroplakins.

    • Research question: How do sequence variations affect plaque formation and stability?

    • Experimental evidence: Studies in mice demonstrated that UPK3A absence results in unusually small urothelial plaques .

  • Signaling Pathway Interactions:

    • Investigation technique: Pull-down assays using recombinant UPK3A to identify cytoplasmic binding partners.

    • Developmental context: The significant cytoplasmic portion of UPK3A (unlike most other uroplakins) suggests potential signaling roles .

    • Application: Understanding how UPK3A may transduce mechanical or chemical signals across the urothelial membrane.

  • Kidney Development Models:

    • Experimental system: Kidney organ cultures treated with recombinant UPK3A or blocking antibodies.

    • Rationale: UPK3A knockout mice show altered renal function indicators , suggesting broader roles beyond the lower urinary tract.

    • Measurable outcomes: Changes in branching morphogenesis, nephron development, and molecular markers of kidney differentiation.

By employing recombinant bovine UPK3A in these diverse experimental approaches, researchers can gain valuable insights into both normal urinary tract development and pathological conditions, potentially leading to novel therapeutic strategies for congenital and acquired urinary tract disorders.

How should researchers interpret conflicting data when comparing UPK3A expression and function across different species models?

Researchers frequently encounter conflicting data when comparing UPK3A across species models. These discrepancies require careful interpretation using a structured analytical approach:

Sources of Cross-Species Variation:

  • Evolutionary Divergence:

    • Sequence homology: While core functional domains are conserved, species-specific sequence variations exist between bovine, human, and mouse UPK3A.

    • Interpretation framework: Map discrepancies to specific protein domains to determine if differences affect functional vs. non-functional regions.

    • Evidence-based approach: Antibody cross-reactivity studies show that some epitopes are conserved across bovine, human, pig, and rat species , while others may be species-specific.

  • Post-translational Modification Differences:

    • Glycosylation patterns: Species-specific glycosylation may affect protein function and antibody recognition.

    • Experimental evidence: Studies in mouse knockouts show that UPK3A ablation affects glycosylation of partner proteins like UPIb , suggesting interdependent modification processes that may vary across species.

    • Resolution strategy: Use deglycosylation enzymes to normalize comparisons or employ recombinant proteins from different expression systems.

Analytical Framework for Resolving Conflicts:

Conflict TypeExampleResolution ApproachConfidence Assessment
Expression Pattern DifferencesDifferent tissue distribution across speciesStandardize detection methods; use multiple antibodies; confirm with mRNA analysisHigh confidence if multiple detection methods show consistent patterns
Functional DisparitiesVarying phenotypic effects in knockout modelsFocus on conserved vs. divergent phenotypes; consider genetic background effectsModerate confidence; requires mechanistic understanding of differences
Molecular Weight VariationsDifferent apparent sizes on Western blotsAnalyze with and without deglycosylation; sequence-based prediction of modificationsHigh confidence when differences can be attributed to specific modifications
Partner Protein InteractionsDifferent binding affinities across speciesUse purified recombinant proteins from all species in identical binding assaysHigh confidence when performed under identical conditions

Case Study Approach to Conflict Resolution:

  • Knockout Phenotype Variations:

    • Observation: Mouse UPK3A knockout studies show urothelial abnormalities and vesicoureteral reflux , but severity may differ in other models.

    • Analytical approach: Quantify phenotypic features using standardized metrics across species (e.g., plaque size measurements, permeability coefficients).

    • Synthesis strategy: Determine if differences are quantitative (severity) or qualitative (presence/absence of phenotype).

  • Structure-Function Relationship Variations:

    • Conflicting data: Different domains may appear critical in different species models.

    • Resolution approach: Use chimeric proteins combining domains from different species to isolate functionally divergent regions.

    • Validation technique: In vitro reconstitution systems using defined components can eliminate confounding variables.

  • Partner Protein Dependency:

    • Observation: Studies in mice show that UPK3A elimination selectively affects UPIb expression and targeting , but strength of this dependency may vary across species.

    • Analytical framework: Quantitative co-expression analysis across species using standardized measurement techniques.

    • Interpretation guide: Distinguish between absolute dependencies (present in all species) and relative dependencies (varying in strength).

When interpreting conflicting data, researchers should prioritize mechanistic explanations over observational differences, and should design experiments that specifically test hypotheses about why cross-species variations occur. This approach transforms conflicts from experimental obstacles into opportunities for deeper biological insight about UPK3A evolution and function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.