Recombinant Bovine Urotensin-2 receptor (UTS2R)

Shipped with Ice Packs
In Stock

Description

Introduction to Urotensin-2 Receptor System

The urotensin-2 receptor (UTS2R) functions as the primary binding site for urotensin-2 (UTS2), a potent vasoconstrictor peptide that regulates both endothelium-dependent and independent vasodilation . Originally identified as orphan G protein-coupled receptor 14 (GPR14) in 1995, it was later confirmed to function specifically as the UTS2 receptor . Interestingly, UTS2R shares highest identity with the somatostatin receptor SSTR4, indicating evolutionary relationships within this receptor family . The binding of UTS2 to UTS2R triggers various physiological responses, including vasoconstriction, glucose metabolism regulation, and effects on fatty acid composition, making it a key target for metabolic research.

The urotensin-2 system has garnered significant attention due to its involvement in insulin resistance and glucose metabolism, which represent core pathological characteristics of type 2 diabetes mellitus (T2DM) . Studies in diabetic tissues have demonstrated dramatic upregulation of both UTS2 and UTS2R expression, with UTS2R showing nearly 2,000-fold increases compared to healthy control tissues . This marked overexpression in pathological conditions highlights the potential importance of understanding recombinant bovine UTS2R for both agricultural applications and as a model for human metabolic disorders.

Gene Organization

Unlike the UTS2 gene which contains multiple exons, the bovine UTS2R gene, like its mammalian orthologs, is characterized as an intronless gene . This distinctive genomic organization has important implications for gene expression regulation and evolutionary conservation. Through comprehensive bioinformatic analysis and sequence alignment, researchers have assembled a complete understanding of the bovine UTS2R gene structure.

Complete Gene Annotation

Detailed annotation of the bovine UTS2R gene reveals a more complex structure than previously recognized. While initial GenBank information indicated that bovine UTS2R contains a 5'UTR of 89 bp and a 3'UTR of 384 bp, more sophisticated electronic rapid amplification of cDNA ends (e-RACE) approaches have refined this understanding . Using genomic DNA sequences flanking the coding regions as queries for BLAST searches against expressed sequence tag (EST) databases, researchers have compiled a tentative full-length cDNA sequence of 2,911 bp for the bovine gene .

The complete bovine UTS2R transcript structure includes:

  • A 5'UTR spanning 1,270 bp

  • A coding sequence of 1,155 bp

  • A 3'UTR of 486 bp

  • A polyadenylation site (AAUAAA) identified in the newly annotated cDNA sequences

This comprehensive annotation provides essential foundations for recombinant expression and functional studies of bovine UTS2R.

Expression Systems for Recombinant UTS2R

Similar to other recombinant receptor proteins, UTS2R can be produced using various expression systems. Although the search results don't provide specific details about bovine UTS2R production, information about recombinant rat UTS2R suggests that mammalian cell expression systems are commonly employed for UTS2R production . These systems likely provide appropriate post-translational modifications necessary for proper receptor folding and function.

When produced recombinantly, UTS2R is typically expressed with affinity tags (such as histidine tags) to facilitate purification . The resulting protein can be obtained in either liquid or lyophilized form, depending on the intended application . Production protocols typically aim for high purity (>80%) and low endotoxin levels (<1.0 EU per μg of protein), which are essential for functional and structural studies .

Quality Control Parameters

For research-grade recombinant bovine UTS2R, several quality control parameters must be assessed:

  1. Purity: Typically >80% as determined by SDS-PAGE and other analytical methods

  2. Endotoxin levels: Generally maintained below 1.0 EU per μg protein

  3. Functional activity: Verified through binding assays with known ligands

  4. Structural integrity: Confirmed via various biophysical approaches

These quality control measures ensure that recombinant bovine UTS2R maintains its native conformational properties and functional activities for experimental applications.

Identified Polymorphisms

Comprehensive genetic screening has revealed remarkable polymorphic diversity within the bovine UTS2R gene. Researchers have identified 14 distinct mutations within this gene, including both single nucleotide polymorphisms (SNPs) and insertion/deletion (INDEL) variants . Specifically, one insertion/deletion (INDEL) with two nucleotides of TA (referenced as AAFC03013715.1: g.2935-36TA>--) was detected in the promoter region, while 13 SNPs were identified in the coding and 3'UTR regions of the gene .

The coding region SNPs include:

  • AAFC03013715.1: c.6446T>C

  • AAFC03013715.1: c.6506C>T

  • AAFC03013715.1: c.6593T>C

  • AAFC03013715.1: c.6749G>A

  • AAFC03013715.1: c.6830T>C

  • AAFC03013715.1: c.6842A>G

  • AAFC03013715.1: c.7232G>A

  • AAFC03013715.1: c.7359C>T

Additional polymorphisms in the 3'UTR include:

  • AAFC03013715.1: g.7466G>C

  • AAFC03013715.1: g.7632A>G

  • AAFC03013715.1: g.7692C>T

  • AAFC03013715.1: g.7714G>A

  • AAFC03013715.1: g.7720G>A

Functional Effects of Polymorphisms

Several of these polymorphisms demonstrate significant functional effects, particularly on fat deposition and fatty acid metabolism in cattle. For genotyping studies, researchers selected key polymorphisms including AAFC03013715.1: g.2935-36TA>-- (the promoter INDEL) and c.6506C>T (a coding SNP) . These variants were then assessed for association with various phenotypic traits in a Wagyu x Limousin reference population.

The promoter INDEL polymorphism showed significant associations with:

  • Monounsaturated fatty acids (MUFA) content (P=0.0452)

  • R2 activity (P=0.0177)

  • Longissimus Dorsi muscle area (LDA) (P=0.0488)

Meanwhile, the coding SNP (c.6506C>T) demonstrated significant impacts on:

  • Saturated fatty acids (SFA) content

  • Monounsaturated fatty acids (MUFA) content

  • Muscle fat marbling score (MFMS, suggestive effect)

Table 1: Effects of UTS2R Polymorphisms on Phenotypic Traits in Cattle

PolymorphismTraitStatistical SignificanceEffect
Promoter INDEL (TA/TA vs. --/--)MUFAP=0.0452+1.65 units higher in TA/TA animals
Promoter INDEL (TA/TA vs. --/--)R2 activityP=0.0177-1.70% lower in TA/TA animals
Promoter INDEL (TA/TA vs. --/--)LD muscle areaP=0.0488-0.56 in² smaller in TA/TA animals
Coding SNP (TT vs. CC)Muscle fat depositionSuggestive+0.64 units higher in TT animals
Coding SNP (TT vs. CC)MUFASignificant+1.82 units higher in TT animals
Coding SNP (TT vs. CC)SFASignificant-1.75 units lower in TT animals

These findings demonstrate the functional significance of UTS2R polymorphisms in regulating fat metabolism and deposition in bovine muscle tissues.

Role in Lipid Metabolism

Research on bovine UTS2R has revealed its critical role in regulating skeletal muscle fat accumulation and fatty acid metabolism . The significant associations between UTS2R polymorphisms and fatty acid composition traits provide compelling evidence for this receptor's involvement in lipid metabolic pathways. Animals with different UTS2R genotypes show marked differences in saturated fatty acid (SFA) and monounsaturated fatty acid (MUFA) content, suggesting that UTS2R signaling directly influences fatty acid synthesis or modification pathways .

The association between UTS2R variants and Δ9 desaturase activity further supports its role in fatty acid metabolism regulation. This enzyme catalyzes the conversion of saturated fatty acids (particularly 16:0) into monounsaturated forms (16:1), a critical step in determining meat quality characteristics in cattle . The finding that UTS2R promoter variants affect this enzymatic activity suggests UTS2R's involvement in regulating lipid desaturation processes, which has significant implications for meat production and quality.

Glucose Metabolism and Insulin Resistance

Beyond lipid metabolism, UTS2R demonstrates important functions in glucose metabolism and insulin resistance. Studies in humans and animal models have established that the urotensin system significantly influences insulin secretion and glucose homeostasis . In healthy rats, infusion of synthetic rat urotensin-2 inhibits both insulin release induced by glucose and insulin responses induced by various secretagogues . Conversely, in diabetic rat models, antagonizing UTS2R improves survival, increases insulin levels, and reduces hyperglycemia and dyslipidemia .

These findings have direct relevance to bovine physiology, as they suggest that UTS2R may represent a critical link between lipid and glucose metabolism in cattle. The significant associations between UTS2R polymorphisms and fat deposition suggest that this receptor may influence insulin sensitivity in bovine tissues, potentially affecting both metabolic efficiency and meat quality traits.

Implications for Livestock Improvement

The identified associations between UTS2R polymorphisms and economically valuable traits like marbling score, muscle area, and fatty acid composition have significant implications for livestock improvement programs . By genotyping cattle for specific UTS2R variants, producers might predict and select for desirable meat quality characteristics, potentially enhancing both nutritional value and consumer acceptance of beef products.

For example, animals with the TT genotype at the c.6506C>T position demonstrate higher muscle fat deposition and increased monounsaturated fatty acids, which are generally associated with better meat flavor and healthier fatty acid profiles . Such genetic information could inform marker-assisted selection strategies to optimize production outcomes without requiring lengthy and expensive phenotypic testing.

Model for Human Metabolic Disorders

The bovine UTS2R also serves as a valuable model for understanding human metabolic disorders, particularly type 2 diabetes mellitus (T2DM). The evidence linking UTS2R to both fat accumulation and glucose metabolism in cattle mirrors findings in human studies, where UTS2R has been implicated in insulin resistance and diabetic complications .

In human diabetic tissues, expression of UTS2R increases dramatically (nearly 2,000-fold) compared to healthy control tissues, indicating its potential role in disease pathogenesis . These parallels suggest that investigations using recombinant bovine UTS2R could provide insights relevant to human health, potentially identifying novel therapeutic approaches for metabolic disorders.

Signal Transduction Pathways

While the search results don't provide detailed information specifically about bovine UTS2R signaling mechanisms, evidence from other mammalian systems suggests that UTS2R primarily signals through Gq/PLC/Ca²⁺ pathways . This signaling cascade triggers intracellular calcium mobilization and subsequent activation of various kinases and transcription factors.

In a humanized UT (UTS2R) mouse model, researchers demonstrated that UTS2R mediates cerebral vasospasm and behavioral deficits through this Gq/PLC/Ca²⁺ signaling pathway, effects that can be prevented by specific UTS2R antagonists . Although this research focused on neurological rather than metabolic outcomes, it provides valuable insights into the fundamental signaling mechanisms of UTS2R that likely apply to bovine systems as well.

Promoter Function and Regulation

Investigations into the promoter regions of bovine UTS2R have revealed that mutations in these regulatory sequences can significantly alter promoter activities, consequently affecting gene expression levels . Using luciferase reporter assays, researchers have demonstrated functional differences between promoter variants, particularly the TA insertion/deletion polymorphism.

These findings suggest that differences in UTS2R expression levels, rather than alterations in receptor structure or function, may underlie some of the observed phenotypic variations associated with UTS2R polymorphisms in cattle. Understanding these regulatory mechanisms provides additional targets for potential manipulation of UTS2R activity in both research and applied contexts.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
UTS2R; GPR14; Urotensin-2 receptor; UR-2-R; G-protein coupled receptor 14; G-protein coupled sensory epithelial neuropeptide-like receptor; SENR; Urotensin II receptor; UR-II-R
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-384
Protein Length
Full length protein
Species
Bos taurus (Bovine)
Target Names
Target Protein Sequence
MALSPEPSSRFLVPATMGSAMPELPGAPNASLNSSLASPTEPNSLEDLVATGTIGVVLSA MGVVGMAGNVYTLTVMCRFLHTSASMYVYVINLALADLLYLLSIPFIVATYVTKRWHFGD VGCRVLFSLDFLTMHASIFTLTLMSRERYAAVVRPLDTVQRSKGYRKVLALGTWLLALLL ALPMMLAIRLVRRGHKSLCLPAWGQRTHRAYLTLLFGTSIVGPGVVIGLLYVRLARAYWL SQRSSFTQTRRLPNPRVLYLILGIVLLFWACFLPFWLWQLLAQYRGAPPLAPRSARIVNY LTTCLTYGNSCVNPFLYTLLTKNYRDYRQRSLHSRGTSGPVGVRSFPQGHTRCQLGSGRS VTSSSQQATETIALSQAVPGSLCV
Uniprot No.

Target Background

Function

High-affinity receptor for urotensin-2 and urotensin-2B. Its activity is mediated by a G-protein coupled receptor that activates a phosphatidylinositol-calcium second messenger system.

Gene References Into Functions
  1. These findings suggest that these genotypes could serve as selection markers for high-grade beef cattle meat production. PMID: 24851282
  2. Urotensin-2 and its receptors play a role in skeletal muscle fat accumulation and fatty acid metabolism, potentially contributing to the pathology of obesity and type 2 diabetes in humans. PMID: 18463714
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in neural tissue, including sensory epithelia.

Q&A

What is the UTS2R protein and what is its basic function?

UTS2R (also known as GPR14) is a class A rhodopsin family G protein-coupled receptor (GPCR) comprising 386 amino acids that primarily binds to the neuropeptide urotensin II. The receptor gained significant scientific attention when researchers discovered that its activation by urotensin II induces exceptionally potent vasoconstriction effects. Beyond this primary function, UTS2R has been implicated in cardiovascular regulation, stress responses, and REM sleep modulation .

The receptor interacts primarily with the Gαq11 protein, activating Protein Kinase C (PKC) and phospholipase C, which increases intracellular calcium through IP3 activation. This signaling cascade mediates many of the receptor's physiological effects. Additionally, UTS2R activation promotes beta-arrestin translocation, which terminates receptor signaling and initiates receptor internalization .

How do the bovine and human UTS2R genes compare structurally?

The bovine UTS2R gene structure differs from its human counterpart in several key aspects. Research has revealed that the human UTS2R cDNA sequence spans 3,288 bp, containing a 5'UTR of 95 bp, a coding sequence of 1,170 bp, and a 3'UTR of 2,023 bp. In contrast, the bovine UTS2R cDNA sequence extends 2,911 bp, with a significantly longer 5'UTR of 1,270 bp, a slightly shorter coding sequence of 1,155 bp, and a much shorter 3'UTR of 486 bp .

Both species' UTS2R genes contain a polyadenylation site (AAUAAA) in their newly annotated cDNA sequences. The coding region variations between species may account for functional differences in ligand binding affinity and downstream signaling pathways, making cross-species extrapolation of experimental results challenging for researchers .

What are the known endogenous ligands for UTS2R and how do they differ?

Two primary endogenous agonists for UTS2R have been identified:

  • Urotensin II (U-II): The primary endogenous ligand whose mRNA is widely distributed across various tissues including the brain and blood vessels. It functions as a potent vasoconstrictor and can influence REM sleep cycles. U-II has been extensively studied for its roles in cardiovascular regulation and metabolic pathways .

  • Urotensin II-Related Peptide (URP): Found in multiple tissues but typically at lower concentrations than U-II, with the notable exception of human reproductive tissues where URP levels significantly exceed those of U-II. The functional differences between URP and U-II in activating UTS2R signaling cascades remain an area of active investigation .

These ligands exhibit different tissue distribution patterns and may activate slightly different downstream signaling pathways, suggesting potential functional specialization in various physiological contexts.

What significant polymorphisms have been identified in the bovine UTS2R gene?

Comprehensive genetic analysis has identified 14 mutations within the bovine UTS2R gene. These polymorphisms are distributed throughout the gene structure, including the promoter region, coding sequences, and untranslated regions. Several of these mutations have demonstrated functional significance in experimental studies .

The identified mutations include single nucleotide polymorphisms (SNPs) that alter the promoter activity of UTS2R, potentially affecting gene expression levels in different tissues. Additionally, coding SNPs within the UTS2R gene may influence mRNA stability, which could significantly impact protein expression levels and cellular responses to ligand binding .

When studied in a Wagyu x Limousin reference population (including 6 F1 bulls, 113 F1 dams, and ~250 F2 progeny), specific UTS2R polymorphisms showed significant associations with economically important traits related to fat deposition and fatty acid composition .

How do mutations in the promoter region affect UTS2R expression and function?

Mutations in the promoter regions of the UTS2R gene have been demonstrated to significantly alter promoter activities, thereby modifying gene expression patterns. Researchers have observed that these regulatory region polymorphisms can either enhance or suppress transcriptional activity, leading to varied UTS2R expression levels across different tissues and individuals .

The altered expression resulting from these promoter mutations has functional consequences. Studies have shown that differential UTS2R expression correlates with variations in fatty acid metabolism, glucose homeostasis, and muscle fat accumulation. These findings suggest that promoter region mutations can contribute to phenotypic diversity in metabolic traits and potentially influence susceptibility to metabolic disorders .

For researchers investigating UTS2R, it is crucial to consider these promoter variants when designing expression studies or interpreting results from different experimental models, as baseline expression levels may vary significantly due to these genetic differences.

What methodologies are most effective for genotyping UTS2R polymorphisms?

For effective genotyping of UTS2R polymorphisms, researchers should consider a multi-phase approach:

  • Initial discovery phase: Utilize whole-genome or targeted sequencing approaches to identify the full spectrum of genetic variants. For bovine UTS2R, this approach successfully identified 14 distinct mutations across the gene .

  • Validation and functional testing: After identifying candidate SNPs, researchers should validate these variants in diverse populations and assess their functional impact through in vitro assays examining promoter activity, mRNA stability, and protein function.

  • High-throughput genotyping: For large population studies, several methodologies have proven effective:

    • TaqMan allelic discrimination assays

    • RFLP (Restriction Fragment Length Polymorphism) analysis

    • KASP (Kompetitive Allele Specific PCR) genotyping

    • SNP microarrays for simultaneous analysis of multiple variants

In the specific case of bovine UTS2R, researchers successfully applied these techniques to genotype four functionally significant mutations in a reference population of over 350 animals, enabling robust association studies with phenotypic traits .

How does UTS2R contribute to glucose metabolism and insulin resistance?

UTS2R plays a complex and sometimes paradoxical role in glucose metabolism, with both acute and chronic effects that appear to operate through distinct mechanisms:

Acute effects: Single administration of urotensin II (U-II), the primary ligand for UTS2R, induces rapid insulin resistance and can trigger immediate hyperglycemia. This acute response may involve:

  • Reduced glucose-evoked insulin release

  • Enhanced hepatic glycogen decomposition (though this mechanism requires further investigation)

  • Temporary disruption of insulin signaling pathways

Chronic effects: Interestingly, prolonged U-II administration (>7 days) demonstrates opposing effects, including improved glucose tolerance in high-fat diet-fed mice. This suggests that UTS2R signaling undergoes adaptive changes with chronic activation, potentially involving:

  • Altered receptor sensitivity or expression

  • Compensatory changes in downstream signaling pathways

  • Modifications to tissue-specific metabolic responses

These contrasting temporal effects highlight the complex regulatory role of the UTS2R system in glucose homeostasis and explain some of the seemingly contradictory findings in the literature regarding its metabolic functions.

What is the relationship between UTS2R and fat deposition in bovine models?

Research utilizing a Wagyu x Limousin reference population has established significant associations between UTS2R gene variants and multiple aspects of fat metabolism and deposition. Specifically, UTS2R genetic polymorphisms demonstrated statistically significant effects on:

  • Fatty acid composition: UTS2R variants influenced both saturated and monounsaturated fatty acid levels in skeletal muscle tissues.

  • Δ9 desaturase activity: Significant associations were observed between UTS2R polymorphisms and the enzymatic conversion of palmitic acid (16:0) to palmitoleic acid (16:1), indicating a role in fatty acid modification pathways.

  • Muscle fat (marbling) score: UTS2R genetic variants correlated with variations in intramuscular fat deposition, a critical economic trait in beef production.

  • Longissimus Dorsi muscle area: UTS2R polymorphisms affected muscle development parameters, suggesting broader influences beyond fat metabolism alone .

Interestingly, while UTS2R demonstrated these significant associations with intramuscular fat parameters, the gene variants showed no significant association with subcutaneous fat depth or percent kidney, pelvic, and heart fat. This tissue-specific effect suggests UTS2R may regulate fat metabolism through mechanisms that differently impact various fat depots .

How do UTS2 and UTS2R knockout models inform our understanding of metabolic regulation?

Genetic knockout models have provided critical insights into the metabolic functions of the urotensinergic system, though with some contradictory findings that highlight the system's complexity:

UTS2 knockout findings:

  • Significant reduction in weight gain compared to wild-type animals

  • Decreased visceral fat accumulation

  • Lower blood pressure

  • Reduced circulating plasma lipids

  • Improved glucose tolerance
    These findings suggest UTS2 may normally promote adiposity and metabolic dysfunction .

UTS2R knockout findings show more contradictory effects:

  • Some studies report similar serum glucose levels to wild-type mice, suggesting limited impact on glucose homeostasis

  • Other research shows elevated serum triglyceride and cholesterol levels compared to wild-type controls

  • When crossed with Apoe knockout mice, the resulting double mutants exhibited more severe atherosclerosis, hyperlipidemia, and hyperinsulinemia than Apoe knockouts alone .

This inconsistency between ligand and receptor knockout models suggests:

  • Possible compensatory mechanisms in one or both models

  • Potential redundancy in signaling pathways

  • UTS2 may act through alternative receptors in some contexts

  • UTS2R might respond to ligands beyond UTS2 and URP

Understanding these complexities is essential for researchers investigating UTS2R as a therapeutic target for metabolic disorders .

What are the optimal expression systems for producing recombinant bovine UTS2R?

For effective production of functional recombinant bovine UTS2R, researchers should consider the following expression systems, each with specific advantages for different experimental applications:

Mammalian cell systems (Recommended for functional studies):

  • HEK293 cells have been successfully used for expression and functional characterization of UTS2R, particularly in ligand binding and signaling studies

  • CHO cells provide stable expression with proper post-translational modifications

  • These systems maintain native receptor trafficking and membrane insertion capabilities

Insect cell systems (Recommended for structural studies):

  • Sf9 or High Five™ insect cells using baculovirus expression vectors

  • Yield higher protein quantities while maintaining most post-translational modifications

  • Particularly useful for purification and structural characterization

Cell-free expression systems:

  • Appropriate for rapid protein production and preliminary binding studies

  • Less suitable for functional assessment due to limited post-translational processing

For optimal results when expressing bovine UTS2R in mammalian systems, researchers should employ codon optimization for the host species, include appropriate signal sequences, and consider fusion tags that facilitate detection without interfering with receptor function. The addition of pharmacological chaperones during expression may also enhance proper folding and membrane targeting of this complex GPCR .

What techniques are most effective for measuring UTS2R binding activity?

Several complementary techniques have proven effective for measuring UTS2R binding activity, each offering distinct advantages:

Competitive binding assays:

  • Employ labeled reference ligands (radioactive or fluorescent) competed with test compounds

  • Effective for determining binding affinities (Ki values) of novel ligands

  • Successfully used to demonstrate remdesivir binding to UTS2R with appropriate controls

Streptavidin-based pulldown assays:

  • Utilizing biotinylated UT2 peptide to capture UTS2R from membrane fractions

  • Optimization with hydrophobic-coated magnetic beads has shown maximum pulldown efficacy with low non-specific binding

  • This approach has successfully demonstrated that compounds like remdesivir can impair biotin-UT2-mediated UTS2R pulldown

Resonance energy transfer techniques:

  • BRET (Bioluminescence Resonance Energy Transfer) or FRET (Fluorescence Resonance Energy Transfer)

  • Allow real-time monitoring of ligand-receptor interactions in living cells

  • Particularly valuable for examining binding kinetics and conformational changes

Surface Plasmon Resonance (SPR):

  • Provides label-free detection of binding interactions

  • Yields both kinetic and equilibrium binding parameters

  • Requires purified receptor preparations, typically incorporated into lipid nanodiscs

How can researchers effectively measure UTS2R-mediated signaling pathways?

For comprehensive characterization of UTS2R-mediated signaling pathways, researchers should implement multiple complementary approaches that target different aspects of the signaling cascade:

Calcium mobilization assays:

  • Utilize fluorescent calcium indicators (Fluo-4, Fura-2) to measure UTS2R-induced intracellular calcium release

  • Provide real-time kinetic data on receptor activation

  • Particularly relevant since UTS2R couples to Gαq11, activating phospholipase C and increasing intracellular calcium through IP3

Phosphorylation analysis:

  • Western blotting with phospho-specific antibodies to detect activation of downstream kinases (PKC, ERK1/2, Akt)

  • Phosphoproteomic approaches for unbiased identification of signaling targets

  • Critical for mapping the complete signaling network activated by UTS2R

β-arrestin recruitment assays:

  • BRET-based techniques to measure UTS2R-induced β-arrestin translocation

  • Important for understanding receptor desensitization mechanisms

  • Can reveal biased signaling properties of different ligands

Gene expression analysis:

  • qRT-PCR or RNA-seq to identify transcriptional changes following UTS2R activation

  • Useful for identifying longer-term cellular adaptations to receptor signaling

  • Has revealed UTS2R's influence on genes involved in lipid metabolism

Functional readouts:

  • Glucose uptake assays in adipocytes or myocytes

  • Fatty acid oxidation measurements

  • Insulin secretion assays in pancreatic β-cells

  • These provide physiologically relevant endpoints that integrate the various signaling events

When designing signaling experiments, researchers should consider time-course analyses, as UTS2R exhibits both rapid (calcium signaling) and delayed (transcriptional) responses, with potentially different implications for metabolic outcomes .

How does remdesivir interact with UTS2R and what are the structural determinants?

Remdesivir has been identified as a selective activator of UTS2R with a half-maximal effective concentration (pEC50) of 4.89 ± 0.03 (EC50 = 13 ± 0.9 μM). This interaction involves specific binding between UTS2R and remdesivir's McGuigan prodrug moiety and nucleoside base through a mechanism distinct from the binding of endogenous ligands .

Key structural determinants in UTS2R for remdesivir binding include:

  • The T304 residue, which when mutated affects receptor interaction with remdesivir

  • The D130 3.32 residue, localized near remdesivir's nucleobase moiety

  • The negative charge of the D130 3.32 residue may create an electron repulsion effect that influences the stability of interaction with the nucleobase

Binding interaction characteristics:

  • Remdesivir can impair biotin-UT2-mediated UTS2R pulldown, suggesting competitive or allosteric interference with endogenous ligand binding

  • The binding is stable enough to allow biochemical pulldown of UTS2R using streptavidin resin

  • Docking models suggest specific interactions with key residues that differ from those involved in endogenous ligand binding

This novel pharmacological interaction between remdesivir and UTS2R has potential implications for understanding both the receptor's structure-function relationships and possible off-target effects of remdesivir therapy.

What methodologies are used to identify novel UTS2R agonists and antagonists?

Researchers employ a multi-tiered approach to identify and characterize novel UTS2R agonists and antagonists:

Primary screening methodologies:

  • Chimeric Gα subunit protein screening: Efficiently detects receptor activation regardless of the specific Gα subunit involved, as demonstrated in the identification of remdesivir as a UTS2R activator

  • High-throughput calcium mobilization assays: Utilizes fluorescent calcium indicators to screen compound libraries for those that trigger or block UTS2R-mediated calcium signaling

  • Virtual screening approaches: Employs computational docking and molecular dynamics simulations to identify potential ligands based on receptor structure predictions

Secondary validation and characterization:

  • Concentration-response analysis: Determines potency parameters (EC50/IC50) of hit compounds, as exemplified by the characterization of remdesivir (EC50 = 13 ± 0.9 μM)

  • Competitive binding assays: Confirms direct interaction with UTS2R and differentiates orthosteric from allosteric modulators

  • Pulldown assays: Using optimized protocols with magnetic beads with hydrophobic coating to achieve maximum efficacy with low non-specific binding

  • Mutagenesis studies: Identifies critical binding residues through systematic receptor mutations, as demonstrated in the characterization of T304 and D130 3.32 residues in remdesivir binding

This comprehensive approach ensures that newly identified compounds are thoroughly characterized, providing critical information about binding mechanism, selectivity, and potential functional outcomes before advancing to more complex biological systems.

How do UTS2R antagonists affect glucose metabolism in preclinical models?

UTS2R antagonists have demonstrated promising effects on glucose metabolism in preclinical models, though with some variability across studies:

Beneficial metabolic effects:

  • Several studies have reported that selective UTS2R antagonists significantly improve glucose tolerance in various animal models

  • Antagonist treatment has been shown to ameliorate metabolic syndrome characteristics

  • These benefits may occur through multiple mechanisms, including enhanced insulin sensitivity, improved β-cell function, and altered hepatic glucose production

Experimental considerations:

  • The timing of antagonist administration appears critical, as UTS2R signaling exhibits both acute and chronic effects on glucose metabolism

  • Baseline metabolic status influences outcomes, with more pronounced benefits typically observed in metabolically compromised models (e.g., diet-induced obesity)

  • Genetic background may modify responses, suggesting interactions with other metabolic regulatory pathways

Mechanistic insights:

  • UTS2R antagonists may counteract the acute hyperglycemic effects of urotensin II, which has been shown to reduce glucose-evoked insulin release

  • Long-term antagonist treatment may prevent the development of insulin resistance in high-fat diet models

  • These compounds may influence metabolic regulation at multiple tissue sites, including liver, skeletal muscle, and adipose tissue

These findings highlight UTS2R antagonism as a potential therapeutic strategy for metabolic disorders, though translation to clinical applications requires careful consideration of timing, dosing, and patient selection based on metabolic phenotype.

What is the role of UTS2R in cardiovascular pathologies?

UTS2R plays significant roles in various cardiovascular pathologies through multiple mechanisms:

Vasculature effects:

  • UTS2R activation by urotensin II produces the most potent vasoconstriction effect documented, significantly exceeding the potency of endothelin-1

  • The receptor regulates both endothelium-dependent and independent vasodilation

  • These potent vascular effects contribute to hypertension and vascular remodeling in pathological conditions

Aneurysm formation:

  • UTS2 and UTS2R are expressed in mononuclear inflammatory cells and spindle-shaped cells in the coronary arterial wall of patients with Kawasaki disease (KD) with coronary artery aneurysms (CAA)

  • Similar expression patterns were observed in femoral endarterectomy specimens from adult patients with peripheral aneurysms following childhood KD

  • These findings suggest UTS2R signaling may contribute to vascular inflammation, aneurysm formation, and arterial remodeling processes

Genetic influences:

  • Host genetics influence UTS2 levels, which may contribute to inflammation and cardiovascular damage in KD

  • UTS2 transcript levels were higher in subjects with KD homozygous for risk alleles in the calcium/sodium channel gene SLC8A1

  • This genetic relationship highlights potential interactions between calcium signaling pathways and UTS2R function in cardiovascular pathology

These mechanisms position UTS2R as a significant contributor to cardiovascular disease processes and a potential therapeutic target for conditions involving vascular dysfunction, inflammation, and abnormal remodeling.

How does UTS2R expression vary in different pathological conditions?

UTS2R expression demonstrates significant variability across different pathological conditions, providing insights into its potential roles in disease processes:

Metabolic disorders:

  • Elevated expression of UTS2R has been documented in the skeletal muscle of diabetic mice

  • This upregulation correlates with insulin resistance and impaired glucose metabolism

  • The expression changes appear to be tissue-specific, with different patterns observed in liver, adipose tissue, and muscle

Cardiovascular diseases:

  • UTS2R expression is altered in vascular tissues during pathological remodeling processes

  • In Kawasaki disease with coronary artery aneurysms, UTS2R is expressed in mononuclear inflammatory cells and spindle-shaped cells in affected arterial walls

  • Expression patterns vary between acute and chronic phases of cardiovascular pathologies

Genetic influences on expression:

  • UTS2R expression levels can be influenced by polymorphisms in its promoter region

  • Mutations that alter promoter activities affect transcriptional regulation

  • Additionally, coding SNPs may affect mRNA stability, further modulating effective receptor expression levels

  • Expression of UTS2 (the ligand) varies as a function of SLC8A1 genotype, suggesting complex genetic networks regulating the urotensinergic system

These variable expression patterns across different pathological states highlight the dynamic regulation of UTS2R and suggest potential value in therapeutic approaches that target tissue-specific or condition-specific aspects of receptor expression and function.

How does the UTS2/UTS2R system contribute to inflammatory processes?

The UTS2/UTS2R system plays multifaceted roles in inflammatory processes across various tissues and disease states:

Vascular inflammation:

  • UTS2 and UTS2R are expressed in mononuclear inflammatory cells within the arterial wall in Kawasaki disease patients with coronary artery aneurysms

  • This expression pattern suggests direct involvement in vascular inflammatory responses

  • The recruitment of inflammatory cells to vascular tissues may be influenced by UTS2R signaling

Metabolic inflammation:

  • The urotensinergic system has been implicated in the low-grade chronic inflammation associated with obesity and insulin resistance

  • UTS2R signaling may influence inflammatory cytokine production in adipose tissue

  • These inflammatory pathways potentially contribute to the development of insulin resistance and type 2 diabetes

Genetic factors modulating inflammatory responses:

  • Genetic variation in calcium signaling pathways (SLC8A1) is associated with both Kawasaki disease susceptibility and UTS2 expression levels

  • This genetic link suggests potential interactions between calcium signaling, UTS2/UTS2R activation, and inflammatory processes

  • The influence of host genetics on UTS2 levels may contribute to individual variations in inflammatory responses and disease susceptibility

Understanding these inflammatory mechanisms is crucial for developing targeted therapeutic approaches that modulate UTS2/UTS2R signaling in inflammatory diseases while minimizing potential side effects on other physiological functions regulated by this system.

How does bovine UTS2R compare functionally with UTS2R in other species?

Bovine UTS2R shares fundamental signaling mechanisms with UTS2R in other species but exhibits species-specific differences in structure, ligand interactions, and physiological functions:

Structural comparisons:

  • Bovine UTS2R contains a coding sequence of 1,155 bp, slightly shorter than the human UTS2R coding sequence of 1,170 bp

  • The bovine UTS2R has a notably longer 5'UTR (1,270 bp vs. 95 bp in humans) and shorter 3'UTR (486 bp vs. 2,023 bp in humans)

  • These structural differences may contribute to species-specific regulation of translation efficiency and mRNA stability

Evolutionary implications:

  • The conservation of the urotensinergic system across vertebrate evolution suggests fundamental physiological importance

  • Species-specific variations likely reflect adaptations to different metabolic demands and environmental pressures

  • The strong association of bovine UTS2R with fat deposition traits may reflect selective pressures related to domestication and breeding for specific production characteristics

These comparative differences highlight the importance of species-specific research when investigating UTS2R functions, as findings from one species may not directly translate to others due to evolutionary divergence in receptor structure and regulation.

What methodological approaches are most effective for cross-species comparison of UTS2R function?

For effective cross-species comparison of UTS2R function, researchers should employ a multi-faceted methodological approach:

Sequence and structural analysis:

  • Comprehensive sequence alignment of UTS2R genes and proteins across species

  • Homology modeling based on available GPCR structures to identify conserved and divergent domains

  • Special attention to transmembrane domains and ligand-binding regions

  • Analysis of untranslated regions (UTRs) that differ significantly between species (e.g., bovine vs. human)

Heterologous expression systems:

  • Expression of UTS2R from different species in standardized cell backgrounds

  • Comparative pharmacological characterization using consistent assay systems

  • Chimeric receptor approaches to identify species-specific functional domains

  • These approaches can isolate receptor properties from background physiological differences

Signaling pathway comparison:

  • Systematic analysis of G-protein coupling preferences across species

  • Assessment of β-arrestin recruitment patterns and kinetics

  • Evaluation of downstream effector activation using phosphoproteomic approaches

  • Identification of species-specific signaling biases or pathway utilization

Functional genomic approaches:

  • CRISPR-Cas9 genome editing to create equivalent mutations across species

  • Cross-species transcriptomic analysis following receptor activation

  • Assessment of tissue-specific expression patterns using comparable methodologies

  • These approaches can reveal evolutionary changes in regulatory networks

By implementing these complementary methods, researchers can distinguish conserved core functions from species-specific adaptations, providing insights into both fundamental UTS2R biology and its evolving roles across different vertebrate lineages .

What are the optimal storage and handling conditions for recombinant UTS2R protein?

To maintain optimal stability and functionality of recombinant UTS2R protein, researchers should adhere to the following storage and handling protocols:

Short-term storage (1-2 weeks):

  • Store membrane preparations containing UTS2R at -20°C in buffer containing 10% glycerol

  • For purified receptor preparations, maintain at 4°C in detergent-containing buffer supplemented with stabilizing ligands

  • Avoid repeated freeze-thaw cycles by preparing single-use aliquots

Long-term storage:

  • Store at -80°C in buffer containing 20% glycerol and protease inhibitor cocktail

  • For purified receptor, consider storage in lipid nanodiscs or vitrification techniques

  • Document storage duration effects on binding activity through quality control testing

Handling precautions:

  • Maintain samples on ice during experimental procedures

  • Minimize exposure to strong reducing agents that may disrupt critical disulfide bonds

  • Shield from direct light when receptor is conjugated with fluorescent tags

  • Process samples rapidly to minimize time at room temperature

Stabilization strategies:

  • Addition of high-affinity ligands during purification and storage can significantly enhance stability

  • Cholesterol hemisuccinate or other membrane-mimetic additives improve stability of detergent-solubilized receptor

  • Consider fusion partners (e.g., T4 lysozyme) that have been shown to stabilize other GPCRs

Researchers should validate each new preparation through binding assays and functional tests to ensure that storage conditions maintain receptor integrity for their specific experimental applications .

What controls are essential for validating UTS2R binding and signaling assays?

Robust experimental design for UTS2R studies requires comprehensive controls to ensure validity and reproducibility:

Binding assay controls:

  • Positive controls: Include known UTS2R ligands (urotensin II, URP) at established concentrations to verify assay functionality

  • Negative controls: Non-transfected cells or membranes to establish baseline binding

  • Non-specific binding controls: Determine non-specific binding by including excess unlabeled ligand

  • Competitive displacement controls: Include concentration gradients of known competitors

  • Vehicle controls: Ensure solvents used for test compounds don't interfere with binding

Signaling assay controls:

  • Pathway-specific positive controls: Direct activators of downstream pathways (e.g., PMA for PKC, ionomycin for calcium) to verify cellular responsiveness

  • Receptor-specific antagonists: To confirm observed signals are UTS2R-dependent

  • Kinetic controls: Include time-course measurements to capture both rapid and delayed signaling events

  • Dose-response relationships: Establish full curves rather than single concentrations

  • Genetic controls: UTS2R-knockout or siRNA-treated cells to confirm specificity

Special considerations for recombinant systems:

  • Expression level verification: Western blot or flow cytometry to quantify receptor expression

  • Subcellular localization: Immunofluorescence to confirm proper membrane targeting

  • Receptor functionality: Verify that recombinant UTS2R responds to endogenous ligands with expected potency

  • Species-appropriate ligands: When studying bovine UTS2R, consider potential species-specific pharmacology

Implementation of these comprehensive controls ensures that experimental observations can be confidently attributed to specific UTS2R interactions rather than non-specific effects or technical artifacts.

What are the current technological limitations in UTS2R research and potential solutions?

Current UTS2R research faces several technological challenges that limit comprehensive understanding of this receptor system:

Structural characterization limitations:

  • Challenge: Obtaining high-resolution structural data for UTS2R remains difficult due to the inherent challenges of membrane protein crystallization

  • Solution: Application of emerging techniques such as cryo-electron microscopy and computational approaches like AlphaFold for structure prediction

  • Consideration of lipid nanodiscs or novel detergents that better maintain receptor conformational integrity

Species-specific reagent limitations:

  • Challenge: Limited availability of validated antibodies and tools specific to bovine UTS2R

  • Solution: Development of recombinant antibody technologies specifically targeting bovine UTS2R epitopes

  • Generation of tagged constructs that maintain physiological function while enabling detection

Signaling complexity challenges:

  • Challenge: Difficulties in discriminating primary from secondary effects in complex signaling networks

  • Solution: Implementation of CRISPR-based genetic screens to identify key pathway components

  • Application of phosphoproteomics and temporal signaling analysis with high temporal resolution

In vivo research limitations:

  • Challenge: Current models may not fully recapitulate the complexity of UTS2R function across tissues

  • Solution: Development of tissue-specific and inducible knockout/knockin models

  • Application of advanced tissue clearing and 3D imaging to visualize receptor expression across intact tissues

Pharmacological tool limitations:

  • Challenge: Limited availability of highly selective agonists and antagonists for mechanistic studies

  • Solution: High-throughput screening approaches coupled with medicinal chemistry optimization

  • Development of biased ligands that selectively activate specific signaling pathways

By addressing these limitations through technological innovation and methodological refinement, researchers can advance UTS2R research toward a more comprehensive understanding of this physiologically important receptor system.

Data Table 1: Key Mutations and Effects in Bovine UTS2R

LocationMutation TypeFunctional EffectAssociated PhenotypeReference
Promoter RegionSNPs (Multiple)Altered promoter activityChanges in gene expression
Coding RegionMissense SNPsAffects mRNA stabilityAltered protein expression
VariousUnspecified (14 total)Multiple effectsFat deposition, fatty acid composition
Δ9 desaturase regionRegulatory SNPsAltered enzymatic activityChanged conversion of 16:0 to 16:1

Data Table 2: Comparative Ligand Properties for UTS2R

LigandTypeBinding AffinityPrimary Signaling PathwayTissue DistributionReference
Urotensin IIEndogenous peptideHighGαq11/PKC/calciumBrain, blood vessels
URP (Urotensin II-Related Peptide)Endogenous peptideHighGαq11/PKC/calciumMultiple tissues, high in reproductive tissues
RemdesivirSynthetic compoundModerate (EC50 = 13 ± 0.9 μM)Activation pathway similar to endogenous ligandsN/A (pharmaceutical)

Data Table 3: UTS2R Effect on Metabolic Parameters in Different Models

Model SystemUTS2R ManipulationGlucose Metabolism EffectLipid Metabolism EffectTimeframeReference
High-fat diet miceChronic U-II administration (>7 days)Improved glucose toleranceReduced weight of adipose tissueLong-term
VariousAcute U-II administrationInsulin resistance, hyperglycemiaNot reportedImmediate
UTS2 knockout miceGene deletionImproved glucose toleranceReduced weight gain, visceral fat, and plasma lipidsN/A
UTS2R knockout miceGene deletionVariable effects on glucoseElevated serum triglyceride and cholesterolN/A
Wagyu x Limousin cattleNatural genetic variationNot directly assessedSignificant effects on muscle fat score and fatty acid compositionN/A

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.