Recombinant Bovine V-type proton ATPase 16 kDa proteolipid subunit (ATP6V0C)

Shipped with Ice Packs
In Stock

Description

Role in V-ATPase

ATP6V0C is a core component of the V₀ domain of V-ATPase, a multi-subunit enzyme responsible for acidifying intracellular organelles (e.g., lysosomes, Golgi apparatus) by transporting protons across membranes . The V₀ domain consists of five subunits (a, b, c, c', d), where ATP6V0C forms the proteolipid c-ring, essential for proton translocation .

Expression Platforms

Recombinant bovine ATP6V0C is produced using diverse host systems:

Host SystemPurityApplications
E. coli≥85% (SDS-PAGE)Structural studies, functional assays
Yeast≥85%Large-scale production, post-translational modifications
Baculovirus≥85%Membrane protein reconstitution
Mammalian Cells≥85%Native conformational studies

Cloning and Vector Design

  • Vectors: pCMV6-AC-GFP or similar plasmids with neomycin resistance for mammalian selection .

  • Tagging: C-terminal GFP or Myc-DDK tags for purification and localization studies .

Cancer Metabolism

ATP6V0C interacts with pyruvate kinase M2 (PKM2), enhancing aerobic glycolysis in esophageal cancer cells. Silencing ATP6V0C reduces lactate production, extracellular acidification, and PKM2 phosphorylation (Tyr105), impairing tumor growth .

Neurological Disorders

Mutations in ATP6V0C (e.g., Ala22Thr) disrupt proton transport, leading to epilepsy and neurodevelopmental abnormalities. Functional studies in Drosophila and C. elegans show increased seizure-like behavior and reduced lifespan .

Autophagy Regulation

In neuroblastoma cells, ATP6V0C knockdown blocks lysosomal acidification, inhibiting autophagic flux and increasing α-synuclein and APP C-terminal fragment accumulation .

Comparative Analysis: Bovine vs. Human ATP6V0C

ParameterBovine ATP6V0CHuman ATP6V0C
Host SystemsE. coli, yeast, mammalian cells E. coli, baculovirus, mammalian cells
Expression YieldHigh (bacterial systems)Moderate (mammalian systems)
Functional StudiesProton transport assays, cancer models Neurological disorder models
Purity≥85% (SDS-PAGE) ≥85% (SDS-PAGE)

Challenges and Future Directions

  • Stability: Recombinant ATP6V0C requires careful handling to maintain membrane-integrated conformation .

  • Functional Validation: Activity assays (e.g., LysoSensor fluorescence, V-ATPase inhibitor response) are critical for confirming functionality .

  • Therapeutic Potential: Targeting ATP6V0C in cancer or neurodegenerative diseases may leverage its role in pH regulation and metabolism .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
ATP6V0C; ATP6C; ATP6L; V-type proton ATPase 16 kDa proteolipid subunit; V-ATPase 16 kDa proteolipid subunit; Vacuolar proton pump 16 kDa proteolipid subunit
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-155
Protein Length
Full length protein
Species
Bos taurus (Bovine)
Target Names
Target Protein Sequence
MSEAKNGPEYASFFAVMGASAAMVFSALGAAYGTAKSGTGIAAMSVMRPEMIMKSIIPVV MAGIIAIYGLVVAVLIANSLNDGISLYRSFLQLGAGLSVGLSGLAAGFAIGIVGDAGVRG TAQQPRLFVGMILILIFAEVLGLYGLIVALILSTK
Uniprot No.

Target Background

Function
Proton-conducting pore forming subunit of the membrane integral V0 complex of vacuolar ATPase. V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells.
Database Links
Protein Families
V-ATPase proteolipid subunit family
Subcellular Location
Vacuole membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.