Recombinant Bovine V-type proton ATPase subunit S1 (ATP6AP1)

Shipped with Ice Packs
In Stock

Description

Introduction to ATP6AP1 and Its Recombinant Form

ATP6AP1 (V-type proton ATPase subunit S1) is an accessory subunit of the vacuolar-ATPase (V-ATPase) complex, critical for acidifying intracellular organelles and regulating membrane trafficking. The recombinant bovine form is a bioengineered protein expressed in E. coli for research and therapeutic applications. It retains structural and functional homology to native ATP6AP1, enabling studies on V-ATPase assembly, proton transport, and disease mechanisms.

Functional Roles in V-ATPase Activity

ATP6AP1 facilitates V-ATPase assembly and stability:

  • Guides Subcellular Localization: Directs V-ATPase to specialized compartments (e.g., osteoclast ruffled borders, neuroendocrine vesicles) .

  • Stabilizes V0 Domain: Interacts with subunits d1 and c-ring to anchor the proton-translocating V0 domain .

  • Iron Homeostasis: Regulates Fe²⁺ prolyl hydroxylase activity, influencing HIF1A degradation .

Functional Studies

  • Osteoclast Function: Ac45 (ATP6AP1) knockdown impairs lysosomal trafficking and bone resorption .

  • Endosomal Acidification: Loss of ATP6AP1 disrupts endocytic flux, leading to granular cell tumor (GCT) pathogenesis .

  • V-ATPase Biogenesis: ATP6AP1 and ATP6AP2 jointly stabilize V0 assembly and subunit d recruitment .

Disease Associations

Mutations in ATP6AP1 are linked to:

  • Granular Cell Tumors (GCTs): Endosomal trafficking defects due to impaired V-ATPase activity .

  • Immunodeficiency: Disrupted lysosomal acidification in immune cells .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. Please specify your required tag type for prioritized development.
Synonyms
ATP6AP1; ATP6IP1; ATP6S1; V-type proton ATPase subunit S1; V-ATPase subunit S1; V-ATPase Ac45 subunit; V-ATPase S1 accessory protein; Vacuolar proton pump subunit S1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
36-468
Protein Length
Full Length of Mature Protein
Species
Bos taurus (Bovine)
Target Names
Target Protein Sequence
ATSEQQVPLVLWSSDRGLWAPAADTHEGHITSDMQLSTYLDPALELGPRNVLLFLQDKLS IEDFTAYGGVFGNKQDSAFSNLENALDLAPSSLVLPAVDWYAISTLTTYLQEKLGASPLH VDLATLQELKLNASIPALLLIRLPYTASSGLMAPKEVLMGNDEVIGQVLSTLKSEDIPYT AALTAVRPSRVARDVAMVTGGLGRQLLQRTVVPPTMNVPVSYNDSYDTRILFWAQNFSVA YGEHWEDLTSRTFGVQDLNLTGSFWNDTVARLVLTYDSLFGTMVTFKFILANSYYSVSAR HWFTLENLEIHSNGSVAYFNASQVTGPSIYSFHCEHVSSENEDGNLLVPDTQPSLWQMTF RDFQIQAFNVTDKKFSYASDCAGFFSPGIWMGLLTSLFMLFIFTYGLHMILSLKTMDRFD DHKGPTITLTQIV
Uniprot No.

Target Background

Function

Accessory subunit of the proton-transporting vacuolar (V)-ATPase protein pump, crucial for luminal acidification of secretory vesicles. It guides the V-type ATPase into specialized subcellular compartments, such as neuroendocrine regulated secretory vesicles or the osteoclast ruffled border, thereby regulating its activity. It's involved in membrane trafficking and Ca2+-dependent membrane fusion and may play a role in V-type ATPase complex assembly. Under aerobic conditions, it participates in intracellular iron homeostasis, activating Fe2+ prolyl hydroxylase (PHD) enzymes, leading to HIF1A hydroxylation and subsequent proteasomal degradation.

Database Links

KEGG: bta:327687

STRING: 9913.ENSBTAP00000016073

UniGene: Bt.4442

Protein Families
Vacuolar ATPase subunit S1 family
Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein. Endoplasmic reticulum-Golgi intermediate compartment membrane.

Q&A

What is the molecular structure of bovine ATP6AP1 and how is it processed in different tissues?

Bovine ATP6AP1 encodes the accessory protein Ac45 of the V-ATPase complex, which is synthesized as a 62-kDa precursor protein. Similar to human ATP6AP1, bovine Ac45 undergoes tissue-specific processing. In neural tissues, the protein is predominantly found in a cleaved ~40-kDa form, while hepatic tissues maintain the intact 62-kDa protein. B-cells demonstrate a distinct 50-kDa isoform . This tissue-specific processing is critical for regulating V-ATPase assembly and function across different cellular environments. The protein contains both N-terminal and C-terminal domains with distinct functional properties, with most disease-causing mutations identified in the C-terminal region .

How is ATP6AP1 evolutionarily conserved across species?

ATP6AP1 shows remarkable evolutionary conservation in key functional domains. Amino acids affected by pathogenic mutations (including L144, Y313, E346, and M428) are highly conserved down to fruitfly, tetraodon, and frog . Interestingly, while standard BLAST searches may not readily identify homologs in more distant species, advanced homology detection at the sequence profile level has revealed that Ac45 is the functional ortholog of yeast V-ATPase assembly factor Voa1 . Processed wild-type Ac45, but not its disease mutants, can restore V-ATPase-dependent growth in Voa1 mutant yeast, confirming functional conservation despite sequence divergence .

What is the expression pattern of ATP6AP1 in bovine tissues?

Similar to human tissue expression patterns, bovine ATP6AP1 shows variable expression levels across tissues. The highest expression typically occurs in neural tissues, with lower expression in liver and intestinal tissues . Western blot analysis reveals tissue-specific Ac45 protein isoforms, including the predominant cleaved ~40-kDa form in brain tissue, the intact 62-kDa protein in liver, and a distinct 50-kDa isoform in immune cells . These expression patterns suggest tissue-specific regulation of V-ATPase assembly and function.

What are the optimal methods for recombinant expression and purification of bovine ATP6AP1?

For successful expression of recombinant bovine ATP6AP1, researchers should consider the following methodological approach:

  • Expression System Selection: Mammalian expression systems (HEK293 or CHO cells) are preferred for bovine ATP6AP1 expression to ensure proper post-translational modifications and processing.

  • Construct Design: Include a cleavable tag (His6 or FLAG) that allows for affinity purification without interfering with protein function. Consider expressing domain-specific constructs separately (N-terminal vs. C-terminal domains) as the full-length protein may be processed.

  • Purification Strategy: Use a two-step purification approach combining affinity chromatography (Ni-NTA for His-tagged proteins) followed by size exclusion chromatography to separate different Ac45 processing forms.

  • Functional Validation: Confirm protein functionality through V-ATPase assembly assays or yeast complementation studies, similar to how wild-type human Ac45 restored V-ATPase-dependent growth in Voa1 mutant yeast .

How can researchers effectively study ATP6AP1 interactions with other V-ATPase components?

To investigate ATP6AP1 interactions with other V-ATPase components:

  • Co-immunoprecipitation (Co-IP): Use anti-ATP6AP1 antibodies to pull down protein complexes from bovine tissue or cell lysates, followed by mass spectrometry to identify binding partners.

  • Proximity Labeling: Employ BioID or APEX2 approaches by fusing these enzymes to ATP6AP1 to identify proximal proteins in the native cellular environment.

  • Yeast Two-Hybrid Screening: For direct binary interactions, screen bovine ATP6AP1 against other V-ATPase components.

  • Protein-Protein Interaction (PPI) Network Analysis: Use databases like STRING for computational prediction of interactions, followed by experimental validation .

  • Cryo-EM Analysis: For structural characterization of the assembled complex, use cryo-electron microscopy to determine how ATP6AP1 integrates into the V-ATPase complex.

What approaches can be used to study tissue-specific processing of bovine ATP6AP1?

To investigate the tissue-specific processing of bovine ATP6AP1:

  • Tissue-Specific Western Blot Analysis: Use antibodies targeting different epitopes (N-terminal vs. C-terminal) to identify processing patterns across various bovine tissues.

  • Pulse-Chase Experiments: Track the processing kinetics of newly synthesized ATP6AP1 in different cell types derived from various bovine tissues.

  • Mass Spectrometry: Employ proteomic approaches to precisely map processing sites and identify tissue-specific post-translational modifications.

  • Cell-Type Specific Expression Systems: Generate constructs expressing bovine ATP6AP1 in different cell types to study cell-autonomous processing patterns.

  • Inhibitor Studies: Use protease inhibitors to identify the specific proteases responsible for ATP6AP1 processing in different tissue contexts.

How do mutations in ATP6AP1 affect V-ATPase activity and cellular physiology?

Mutations in ATP6AP1 disrupt V-ATPase function through several mechanisms:

  • Assembly Defects: Disease-causing mutations (L144P, Y313C, E346K, M428I) prevent proper assembly of the V-ATPase complex, as demonstrated by the inability of mutant Ac45 to complement Voa1-deficient yeast .

  • Organelle Acidification: Mutations lead to impaired acidification of intracellular compartments, affecting processes like protein glycosylation, endosomal trafficking, and lysosomal degradation.

  • Tissue-Specific Effects: The impact of mutations varies by tissue, corresponding to the tissue-specific processing patterns of ATP6AP1. For example, mutations in the E346 position are associated with more severe phenotypes, including hepatic dysfunction and neurological abnormalities .

  • Molecular Consequences: Different mutations result in varying severities of clinical manifestations. For example, patients with E346K mutations demonstrate a more severe clinical course with hepatic failure and neurological symptoms compared to those with other mutations .

What is the relationship between ATP6AP1 expression and immune system function?

ATP6AP1 plays critical roles in immune function:

  • B-Cell Function: Human patients with ATP6AP1 mutations display hypogammaglobulinemia, suggesting a crucial role in B-cell function and antibody production .

  • Immune Cell Infiltration: In cancer contexts, ATP6AP1 expression negatively correlates with immune cell infiltration, including B cells, dendritic cells, and T cells, suggesting immunomodulatory functions .

  • Immune Microenvironment: High ATP6AP1 expression is associated with lower ImmuneScore and StromalScore, indicating an immunosuppressive microenvironment .

  • Specific Immune Cell Populations: ATP6AP1 expression negatively correlates with numerous immune cell populations, including macrophages, B cells, dendritic cells, cytotoxic cells, NK cells, and T cells .

  • Immunodeficiency Pattern: ATP6AP1 mutations result in a specific pattern of immunodeficiency that differs from other V-ATPase-related disorders, suggesting a unique role in immune development .

How can CRISPR-Cas9 technology be applied to study ATP6AP1 function in bovine cell lines?

CRISPR-Cas9 offers powerful approaches for studying ATP6AP1:

  • Knockout Studies: Generate complete ATP6AP1 knockout in bovine cell lines to assess cellular phenotypes, though complete loss may be lethal based on the essential nature of V-ATPase function.

  • Knock-in Models: Create knock-in models of specific disease-associated mutations (e.g., L144P, Y313C, E346K, M428I) to study their functional consequences in bovine cells.

  • Domain-Specific Editing: Target specific domains to understand their functional contributions, including the N-terminal domain versus the processed C-terminal domain.

  • Conditional Systems: Implement inducible CRISPR systems to control the timing of ATP6AP1 disruption, allowing for temporal studies of its function.

  • Base Editing: Use CRISPR base editing to introduce specific point mutations without double-strand breaks, minimizing off-target effects when studying precise amino acid changes.

What biomarker potential does ATP6AP1 have in bovine disease models?

Research on human ATP6AP1 suggests several biomarker applications that may translate to bovine systems:

  • Diagnostic Potential: The high specificity of ATP6AP1 expression patterns may serve as a diagnostic marker in certain conditions, as demonstrated by its ability to distinguish cancer from normal tissue with an AUC of 0.939 in human studies .

  • Prognostic Indicator: ATP6AP1 expression correlates with disease outcomes in cancer contexts, with higher expression associated with poorer prognosis .

  • Therapeutic Response Prediction: Expression levels may predict response to treatments targeting V-ATPase function or related pathways.

  • Monitoring Disease Progression: Changes in ATP6AP1 expression or processing patterns could serve as markers of disease progression.

  • Immune Status Assessment: Given its correlation with immune cell infiltration, ATP6AP1 expression may serve as a marker of immune status in inflammatory or infectious conditions .

What experimental models best recapitulate bovine ATP6AP1 function in vitro?

To effectively model bovine ATP6AP1 function:

  • Primary Bovine Cell Cultures: Establish cultures from relevant tissues (brain, liver, immune cells) to study tissue-specific processing and function.

  • Bovine Organoids: Develop organoid systems from bovine tissues to study ATP6AP1 in three-dimensional tissue-like environments.

  • Immortalized Bovine Cell Lines: Use established bovine cell lines with genetic modifications to study specific aspects of ATP6AP1 function.

  • Heterologous Expression Systems: Express bovine ATP6AP1 in yeast V-ATPase assembly factor (Voa1) mutants to assess functional complementation, as demonstrated with human ATP6AP1 .

  • Ex Vivo Tissue Cultures: Maintain bovine tissue explants in culture to study ATP6AP1 in a context that preserves tissue architecture and cellular interactions.

How is ATP6AP1 expression regulated at the transcriptional level?

Understanding transcriptional regulation of ATP6AP1:

  • Transcription Factor Analysis: The PROMO database has been used to predict transcription factor binding sites for ATP6AP1, identifying potential regulatory proteins .

  • Tissue-Specific Expression Patterns: Despite lower expression at the mRNA level in liver compared to brain, different processing patterns are observed at the protein level, suggesting complex regulatory mechanisms .

  • Epigenetic Regulation: Consider assessing DNA methylation and histone modifications at the ATP6AP1 locus to understand epigenetic control mechanisms.

  • Promoter Analysis: Characterize the bovine ATP6AP1 promoter region to identify regulatory elements controlling tissue-specific expression.

  • Transcriptional Response: Evaluate how cellular stressors and signaling pathways influence ATP6AP1 transcription across different bovine tissues.

What role do miRNAs play in regulating ATP6AP1 expression?

miRNA regulation of ATP6AP1:

  • miRNA Prediction: The starBase database has been used to predict potential miRNAs that target ATP6AP1, offering candidates for experimental validation .

  • Tissue-Specific miRNA Regulation: Different miRNAs may regulate ATP6AP1 in a tissue-specific manner, contributing to differential expression patterns.

  • Functional Validation Approaches: Methods including luciferase reporter assays, miRNA mimics/inhibitors, and CLIP-seq can verify miRNA interactions with ATP6AP1 mRNA.

  • miRNA in Disease Contexts: Altered miRNA expression in disease states may contribute to dysregulated ATP6AP1 expression.

  • Therapeutic Implications: Understanding miRNA regulation opens potential avenues for therapeutic intervention targeting ATP6AP1 expression.

Data Table: ATP6AP1 Disease-Associated Mutations and Clinical Manifestations

MutationProtein DomainClinical ManifestationsBiochemical ImpactReference
L144PN-terminal domainImmunodeficiency with hypogammaglobulinemia; milder phenotypeImpaired V-ATPase assembly
Y313CProcessed C-terminal domainImmunodeficiency with hypogammaglobulinemia; milder phenotypeImpaired V-ATPase assembly
E346KProcessed C-terminal domainSevere phenotype: immunodeficiency, hepatopathy, neurological symptoms (epilepsy, intellectual disability)Failed complementation in yeast; severe V-ATPase dysfunction
M428IProcessed C-terminal domainImmunodeficiency with hypogammaglobulinemia; milder phenotypeImpaired V-ATPase assembly

What emerging technologies could advance our understanding of ATP6AP1 function?

Several cutting-edge approaches hold promise for ATP6AP1 research:

  • Single-Cell Transcriptomics: Apply single-cell RNA sequencing to characterize cell type-specific expression patterns of ATP6AP1 in complex bovine tissues.

  • Spatial Transcriptomics: Use spatial profiling to understand ATP6AP1 expression in the context of tissue architecture and microenvironments.

  • Cryo-Electron Tomography: Employ this technique to visualize ATP6AP1 within the V-ATPase complex in its native cellular environment.

  • Interactome Profiling: Use proximity labeling techniques like TurboID to comprehensively map ATP6AP1 protein interactions under different physiological conditions.

  • Metabolomics Integration: Combine ATP6AP1 functional studies with metabolomic analyses to understand how it influences cellular metabolic pathways, particularly iron metabolism, glutathione metabolism, and pyruvate metabolism as suggested by GSEA studies .

How might ATP6AP1 research inform therapeutic development for V-ATPase-related disorders?

ATP6AP1 research has significant therapeutic implications:

  • Target Validation: Understanding ATP6AP1's precise role in V-ATPase assembly validates it as a potential therapeutic target.

  • Tissue-Specific Approaches: The distinct processing patterns across tissues suggest opportunities for tissue-targeted interventions.

  • Mutation-Specific Therapies: Different mutations (e.g., L144P vs. E346K) result in varying phenotypic severity, suggesting personalized therapeutic approaches may be beneficial.

  • Small Molecule Screening: Identify compounds that can rescue V-ATPase assembly defects caused by specific ATP6AP1 mutations.

  • Gene Therapy Potential: For severe ATP6AP1 deficiencies, gene replacement therapies may restore normal V-ATPase function in affected tissues.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.