Recombinant Bovine Vacuolar ATPase assembly integral membrane protein VMA21 (VMA21)

Shipped with Ice Packs
In Stock

Description

Molecular Structure and Functional Domains

Bovine VMA21 is a small integral membrane protein (~10 kDa) with two transmembrane domains and cytosolic N- and C-termini . Key features include:

  • ER Retention Motif: A dilysine (-KKXX) motif at the C-terminus ensures retrieval from the Golgi to the endoplasmic reticulum (ER), where it facilitates V-ATPase V₀ domain assembly .

  • Proteolipid Interaction Site: Binds proteolipid subunits (e.g., ATP6V0C) to stabilize the V₀ domain during assembly .

Table 2: Production Parameters for Recombinant Bovine VMA21

ParameterDetail
Host SystemE. coli (BL21-DE3)
TagGST or His-tag
Yield~1–2 mg/L culture
StabilityLyophilized with trehalose/mannitol protectants

Functional Insights from Orthologs

Studies on human and yeast VMA21 homologs provide critical insights into bovine VMA21’s role:

  • Assembly Mechanism:

    • VMA21 stabilizes the V₀ domain in the ER by bridging proteolipid subunits (e.g., ATP6V0C) and assembly factors like ATP6AP2 .

    • Loss of VMA21 disrupts V₀ assembly, leading to V-ATPase dysfunction, lysosomal deacidification, and impaired autophagy .

  • Disease Relevance:

    • Mutations in human VMA21 cause X-linked myopathy with excessive autophagy (XMEA) and congenital disorders of glycosylation (CDG) .

    • In colorectal cancer, elevated VMA21 correlates with improved survival, suggesting tumor-suppressive roles .

Applications in Research

Recombinant bovine VMA21 is utilized in:

  • Mechanistic Studies: Reconstituting V-ATPase assembly in vitro .

  • Disease Modeling: Investigating lipid metabolism defects (e.g., hepatic steatosis) linked to V-ATPase dysfunction .

  • Drug Screening: Identifying compounds that enhance V-ATPase activity in lysosomal storage disorders .

Challenges and Future Directions

  • Species-Specific Isoforms: Bovine VMA21 may have splice variants (e.g., muscle-specific isoforms) akin to human VMA21-120 and VMA21-101 .

  • Therapeutic Potential: Targeting VMA21 could modulate autophagy in cancers or metabolic diseases .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us for preferential development.
Synonyms
VMA21; Vacuolar ATPase assembly integral membrane protein VMA21
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-101
Protein Length
Full length protein
Species
Bos taurus (Bovine)
Target Names
VMA21
Target Protein Sequence
MERLDKAALNALQPSDFRNESSLASTLKTLLFFTALMITVPIGLYFTTKSYVFEGAFGMS NRDSYFYAAIVAVVAVHVVLALFVYVAWNEGSRQWREGKQD
Uniprot No.

Target Background

Function
Essential for the assembly of the V0 complex of the vacuolar ATPase (V-ATPase) within the endoplasmic reticulum.
Database Links
Protein Families
VMA21 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Endoplasmic reticulum-Golgi intermediate compartment membrane; Multi-pass membrane protein. Cytoplasmic vesicle, COPII-coated vesicle membrane; Multi-pass membrane protein.

Q&A

What is the primary function of VMA21 protein in cellular physiology?

VMA21 functions as an essential assembly chaperone for the vacuolar H+-ATPase (V-ATPase) complex, the principal mammalian proton pump. It specifically facilitates the assembly of the V₀ domain in the endoplasmic reticulum (ER) . VMA21 is the human ortholog of the yeast Vma21p protein and shares approximately 30% similarity with it, although the human version lacks the C-terminal dilysine motif necessary for ER retrieval that is present in yeast . This protein is critical for maintaining proper lysosomal acidification, which in turn is essential for normal autophagic processes. When VMA21 function is compromised, lysosomal pH increases, reducing lysosomal degradative ability and blocking autophagy . This leads to a decrease in cellular free amino acids, downregulation of the mTORC1 pathway, and compensatory increases in macroautophagy—ultimately resulting in the formation of large, ineffective autolysosomes .

How does VMA21 interact with other V-ATPase assembly factors?

VMA21 works in concert with at least four other V-ATPase assembly factors in the endoplasmic reticulum. Research has revealed that VMA21 directly interacts with ATP6AP2 (another assembly factor) and the V₀ subunit ATP6V0C . These interactions are critical for proper V-ATPase assembly. When VMA21 carries mutations such as p.Arg18Gly, p.Asp63Gly, or p.Gly91Ala, these interactions are reduced, even when protein expression levels remain comparable to wild-type VMA21 . This suggests that beyond expression levels, the specific molecular interactions of VMA21 with other V-ATPase components are crucial for proper assembly and function of the proton pump complex.

What are the structural characteristics of VMA21 that enable its function?

VMA21 is a small membrane protein with predicted transmembrane regions. The luminal loop region of the protein, particularly near the second predicted transmembrane region (where mutations like p.Asn63Gly occur), appears critical for function . The protein lacks the C-terminal dilysine motif for ER retrieval that is present in yeast Vma21p, suggesting differences in trafficking mechanisms between species . Structural studies of VMA21 are still emerging, but mutational analyses reveal that key residues like Arg18, Asn63, and Gly91 are functionally important, as substitutions at these positions impair interaction with V-ATPase components and compromise proton pump function .

How do different mutations in VMA21 lead to distinct clinical phenotypes?

Current research indicates that VMA21 mutations result in two distinct clinical entities: X-linked Myopathy with Excessive Autophagy (XMEA) and a Congenital Disorder of Glycosylation (CDG) with autophagic liver disease. The difference in phenotypic expression appears to be related to the severity of VMA21 dysfunction .

The mutations associated with CDG (c.188A>G/p.Asn63Gly, c.-10C>T, and p.Arg18Gly*) cause stronger reductions in VMA21 mRNA levels compared to XMEA-associated mutations (e.g., p.Gly91Ala) . This is evidenced by qPCR analysis showing substantially reduced mRNA expression in CDG patient fibroblasts, suggesting mRNA instability as a mechanism . While both sets of mutations impair V-ATPase assembly by reducing V₀ subunit expression, the more severe impact on protein expression in CDG may explain the broader clinical manifestations including liver involvement and glycosylation abnormalities .

The functional differences between XMEA and CDG mutations are further supported by distinct biochemical findings: patients with CDG show abnormal transferrin isoelectric focusing (TIEF) and apolipoprotein CIII isoelectric focusing (apoCIII-IEF), while these tests are normal in XMEA patients .

What cellular mechanisms are disrupted by VMA21 deficiency?

VMA21 deficiency disrupts multiple cellular pathways through impaired V-ATPase function:

  • Lysosomal acidification: VMA21 mutations reduce proton pump function, leading to elevated lysosomal pH as demonstrated by decreased LysoSensor and LysoTracker staining in patient fibroblasts .

  • Autophagy pathway disruption: The impaired lysosomal acidification prevents proper degradation of autophagic cargo, resulting in blocked autophagy and reduced cellular free amino acids .

  • mTORC1 pathway: The reduction in free amino acids leads to downregulation of the mTORC1 pathway, triggering a compensatory increase in macroautophagy .

  • Formation of ineffective autolysosomes: The compensatory increase in macroautophagy leads to the proliferation of large, ineffective autolysosomes that engulf sections of cytoplasm, merge, and ultimately vacuolate the cell .

  • Protein glycosylation: In CDG patients, VMA21 deficiency causes abnormal N-glycosylation and O-glycosylation of proteins, resulting in truncated glycans lacking galactose and sialic acid .

  • Lipid metabolism: VMA21 deficiency impairs lipophagy and causes ER stress, sequestration of unesterified cholesterol in lysosomes, and activation of sterol response element-binding protein-mediated cholesterol synthesis pathways, explaining the steatosis and hypercholesterolemia observed in patients .

What are the observable ultrastructural changes in tissues affected by VMA21 deficiency?

VMA21 deficiency leads to distinctive ultrastructural changes that serve as diagnostic hallmarks. In skeletal muscle from XMEA patients, electron microscopy reveals characteristic electron-dense vacuoles within myofibers . These vacuoles represent accumulated autolysosomes that are unable to complete the degradation process due to impaired acidification.

In the liver of CDG patients, enlarged lipid droplet-containing autolysosomes are observed in hepatocytes . These findings correspond to the clinical presentation of hepatic steatosis. The zebrafish model of VMA21 deficiency similarly demonstrates electron-dense vacuoles within myofibers, confirming the conservation of this pathological feature across species .

Additionally, immunofluorescence studies show alterations in lysosomal marker distribution, with reduced LAMP1 staining in affected tissues, reflecting compromised lysosomal integrity . These ultrastructural changes provide important diagnostic clues and insights into disease mechanisms.

What animal models have been developed to study VMA21 deficiency, and what are their key phenotypic features?

Recent research has successfully developed a zebrafish model of VMA21 deficiency through CRISPR-Cas9 mutagenesis. This model accurately recapitulates the key features of human disease .

Key phenotypic features of the zebrafish vma21 mutant include:

  • Morphological abnormalities: The mutants display overt phenotypic differences including abnormal body structure .

  • Motor dysfunction: Impaired swim behavior and reduced touch-evoked escape responses are observed .

  • Reduced survival: The mutants have shorter lifespans compared to wild-type zebrafish .

  • Lysosomal dysfunction: Impaired lysosomal acidification and activity are demonstrated by reduced LysoTracker Red and LAMP1 staining .

  • Aberrant autophagy: The mutants exhibit electron-dense vacuoles within myofibers, increased LC3 protein levels, and reduced autophagic flux .

  • Hepatic involvement: The model shows hepatic steatosis, smaller liver size, and impaired bile flux, consistent with liver dysfunction reported in patients with VMA21 mutations .

The zebrafish model provides a valuable tool for investigating disease mechanisms and testing potential therapeutic approaches. Treatment experiments with autophagy modulators in this model have shown promising results, with compounds like edaravone and LY294002 improving birefringence, motor function, and survival .

What functional assays are used to evaluate VMA21 activity and V-ATPase assembly?

Researchers employ several complementary assays to evaluate VMA21 function and V-ATPase assembly:

  • Protein expression analysis: Western blot analysis is used to assess steady-state levels of VMA21 and V-ATPase subunits. This reveals reduced expression of V₀ subunits (ATP6V0D1 and ATP6V0C) in patient fibroblasts while V₁ subunits (ATP6V1D1 and ATP6V1B1/2) remain unaffected, indicating specific impairment of V₀ domain assembly .

  • Interaction studies: Co-immunoprecipitation experiments with myc-tagged wild-type and mutant VMA21 proteins are used to evaluate interactions with assembly factors and V-ATPase subunits. These studies have demonstrated that mutations in VMA21 reduce interaction with ATP6AP2 and ATP6V0C .

  • Yeast complementation assays: A functional assay based on the dependence of yeast V-ATPase activity for survival and growth in the presence of elevated divalent cations (zinc). This test evaluates whether human VMA21 variants can rescue the growth of yeast strains lacking functional Vma21p under nonpermissive conditions .

  • Lysosomal acidification assessment: LysoSensor and LysoTracker dyes are used to evaluate lysosomal acidification in patient fibroblasts. These dyes emit fluorescence only inside acidic cellular compartments, with intensity inversely correlated with pH. Both CDG and XMEA patient fibroblasts show reduced numbers and intensity of LysoSensor and LysoTracker-positive punctae .

  • mRNA expression analysis: Real-time quantitative PCR (qPCR) is used to measure VMA21 mRNA levels in patient cells, revealing reduced expression in both CDG and XMEA patients, with more severe reduction in CDG patients .

What methodologies are used to assess glycosylation abnormalities in VMA21-associated disorders?

Several complementary methods are employed to detect and characterize glycosylation abnormalities in VMA21-associated disorders:

Interestingly, these glycosylation tests are normal in XMEA patients, highlighting a key biochemical difference between the two VMA21-associated disorders .

How do tissue-specific differences in V-ATPase composition influence the clinical phenotype of VMA21 mutations?

While VMA21 is ubiquitously expressed, mutations lead to tissue-specific manifestations primarily affecting skeletal muscle (in XMEA) or liver (in CDG). This tissue specificity likely stems from differences in V-ATPase subunit composition and reliance on VMA21-mediated assembly across tissues.

The V-ATPase complex contains multiple subunit isoforms with tissue-specific expression patterns. For example, skeletal muscle and liver may express different isoforms of V₀ and V₁ subunits, potentially altering their dependence on VMA21 for assembly . Additionally, compensatory mechanisms may exist in certain tissues but not others, explaining why some organs are more vulnerable to VMA21 deficiency.

In VMA21-CDG patients, liver involvement is prominent, with steatosis, elevated aminotransferases, and hypercholesterolemia . Interestingly, even in XMEA patients traditionally thought to have primarily myopathic manifestations, liver parameters may be abnormal. An XMEA patient with p.Gly91Ala mutation showed increased GGT (181 U/L) and high LDL cholesterol (4.1 mmol/L) , suggesting subclinical liver involvement.

The zebrafish model of VMA21 deficiency demonstrates both muscular and hepatic phenotypes, with electron-dense vacuoles in myofibers and hepatic steatosis with impaired bile flux , supporting the multi-system nature of the disease.

What is the relationship between VMA21 deficiency, autophagy dysregulation, and lipid metabolism?

VMA21 deficiency creates a complex relationship between autophagy dysfunction and lipid metabolism abnormalities:

  • Impaired lipophagy: VMA21 deficiency reduces lysosomal acidification, impairing the degradation of lipid droplets through lipophagy. This leads to the accumulation of lipid droplet-containing autolysosomes in hepatocytes, as observed in liver biopsies from VMA21-CDG patients .

  • ER stress and cholesterol metabolism: VMA21 deficiency triggers endoplasmic reticulum stress and causes sequestration of unesterified cholesterol in lysosomes. This activates the sterol response element-binding protein (SREBP)-mediated cholesterol synthesis pathways, explaining the hypercholesterolemia observed in patients .

  • Autophagy compensation and vacuolation: The initial block in autophagy completion leads to reduced cellular free amino acids and downregulation of the mTORC1 pathway. This triggers a compensatory increase in macroautophagy, resulting in the proliferation of large, ineffective autolysosomes that engulf sections of cytoplasm containing lipid droplets and other cellular components .

  • Feedback loop: The accumulation of unprocessed autophagy substrates (including lipids) further compromises lysosomal function, creating a vicious cycle of autophagy dysfunction and lipid accumulation.

The zebrafish model confirms this relationship, showing both autophagy dysregulation (electron-dense vacuoles, increased LC3 levels) and lipid metabolism abnormalities (hepatic steatosis) , making it a valuable tool for studying these interconnected processes.

What therapeutic approaches are being explored for VMA21-associated disorders?

Research into therapeutic approaches for VMA21-associated disorders is still in early stages, but several promising strategies are being explored:

The zebrafish model provides a valuable platform for evaluating these and other therapeutic approaches in a high-throughput manner .

What are the challenges in producing and working with recombinant VMA21 protein?

Recombinant VMA21 production and analysis present several technical challenges:

  • Membrane protein expression: VMA21 is a small integral membrane protein with multiple transmembrane domains, making it difficult to express in recombinant systems. Traditional bacterial expression systems often fail to properly fold such proteins.

  • Protein stability: VMA21 mutations found in patients often lead to reduced protein stability and expression levels, as evidenced by western blot analysis of patient fibroblasts . This instability may extend to recombinant protein production.

  • Functional assessment: As VMA21 functions as an assembly chaperone rather than an enzyme, traditional activity assays are not applicable. Instead, functional assessment requires complex assays such as co-immunoprecipitation with V-ATPase components or yeast complementation studies .

  • Structural analysis: The small size and membrane-embedded nature of VMA21 make structural studies challenging. To date, detailed structural information about VMA21 remains limited.

  • Species differences: Human VMA21 shares only 30% similarity with yeast Vma21p and lacks the C-terminal dilysine motif present in the yeast protein . These differences must be considered when using model systems or cross-species complementation assays.

Researchers have addressed some of these challenges by using epitope-tagged versions of VMA21 (e.g., Myc-tagged) for overexpression studies and interaction analyses , though these modifications may themselves affect protein function.

How can researchers distinguish between direct effects of VMA21 deficiency and secondary consequences?

Distinguishing primary from secondary effects of VMA21 deficiency requires sophisticated experimental approaches:

  • Temporal analysis: Studying the progression of cellular changes over time in inducible VMA21 knockdown systems can help identify which effects occur first (likely primary) versus later (likely secondary).

  • Rescue experiments: Reintroducing wild-type VMA21 into deficient cells and determining which phenotypes are rescued and how quickly can help distinguish direct from indirect effects. Studies have shown that expression of wild-type VMA21 can rescue growth of yeast under elevated zinc conditions, while mutant VMA21 variants fail to do so .

  • Comparison with other V-ATPase assembly defects: Comparing the cellular and clinical phenotypes of VMA21 deficiency with those of other V-ATPase assembly factors (ATP6AP1, ATP6AP2, CCDC115, TMEM199) helps identify common features that are likely direct consequences of impaired V-ATPase function .

  • Combined approaches: Using lysosomal acidification assays (LysoSensor, LysoTracker) alongside autophagy measurements (LC3 levels, autophagic flux) and metabolic assessments can help establish causality chains .

  • In vivo models: The zebrafish model of VMA21 deficiency allows for assessment of organ-specific effects and their progression, helping distinguish primary pathology from secondary adaptations .

  • Pharmacological interventions: Using specific inhibitors or enhancers of different pathways can help determine which processes are causally linked. For example, testing whether V-ATPase inhibitors mimic VMA21 deficiency phenotypes or whether autophagy modulators can rescue certain aspects of the disease .

What are the comparative differences in experimental approaches for studying bovine versus human VMA21?

While the query specifically mentions "Recombinant Bovine VMA21," the search results primarily focus on human VMA21 and zebrafish vma21. Nevertheless, several considerations would apply when comparing experimental approaches for bovine versus human VMA21:

Comparative studies between bovine and human VMA21 could provide valuable insights into conserved versus species-specific aspects of V-ATPase assembly and function.

What are the relative advantages and limitations of different experimental models for studying VMA21 function?

Model SystemAdvantagesLimitationsKey Applications
Patient Fibroblasts- Direct relevance to human disease
- Contain physiological mutations
- Allow study of patient-specific effects
- Limited availability
- May not reflect tissue-specific pathology
- Cannot study lethal mutations
- Confirming pathogenicity of variants
- Studying cellular consequences of VMA21 deficiency
- Testing potential therapies
Zebrafish (vma21 mutant)- Vertebrate model with conserved V-ATPase
- Displays both muscle and liver phenotypes
- Suitable for high-throughput drug screening
- Allows in vivo tissue interaction studies
- Evolutionary distance from mammals
- Some pathway differences from humans
- Limited to modeling complete gene disruption
- Studying disease progression
- Testing therapeutic compounds
- Investigating tissue-specific effects
Yeast (Vma21p)- Well-established V-ATPase assembly model
- Simple growth assays for function
- Genetic manipulability
- Significant evolutionary distance
- Differences in protein structure (e.g., ER retrieval signal)
- Lacks tissue complexity
- Testing functional consequences of mutations
- Complementation assays
- Structure-function studies
Cell Lines with VMA21 Knockdown/Knockout- Controlled genetic background
- Can study acute vs. chronic effects
- Available for various cell types
- May not recapitulate patient mutations
- Potential off-target effects
- Artificial system
- Studying temporal sequence of effects
- Mechanism investigations
- Rescue experiments

How do different analytical techniques compare for assessing V-ATPase assembly and function in the context of VMA21 research?

Analytical TechniqueMeasuresAdvantagesLimitationsKey Findings in VMA21 Research
Western Blot AnalysisProtein expression levels of VMA21 and V-ATPase subunits- Quantitative assessment of protein levels
- Can distinguish V₀ and V₁ subunits
- Does not directly measure assembly
- Limited spatial information
- Reduced VMA21 protein in patient cells
- Selective reduction in V₀ subunits (ATP6V0D1, ATP6V0C) with preserved V₁ subunits
Co-immunoprecipitationProtein-protein interactions- Detects physical interactions
- Can identify specific binding partners
- May detect indirect interactions
- Requires suitable antibodies
- May disrupt weak interactions
- Mutant VMA21 shows reduced interaction with ATP6AP2 and ATP6V0C
qPCRmRNA expression levels- Highly sensitive
- Can detect subtle expression changes
- Does not measure protein levels
- May not reflect functional protein
- Reduced VMA21 mRNA in patient cells, especially in CDG patients
LysoSensor/LysoTrackerLysosomal acidification- Directly measures functional consequence
- Works in living cells
- Visual readout
- Semi-quantitative
- Can be affected by lysosome number
- Reduced number and intensity of acidic compartments in patient fibroblasts
Yeast Growth AssaysFunctional V-ATPase activity- Simple readout
- Tests physiological function
- Established assay
- Indirect measure
- Relies on cross-species compatibility
- VMA21 mutants impair rescue of yeast growth under elevated zinc conditions
Electron MicroscopyUltrastructural changes- High resolution
- Direct visualization of pathology
- Labor intensive
- Small sample size
- Static images
- Characteristic vacuoles in muscle fibers
- Lipid droplet-containing autolysosomes in hepatocytes
Glycosylation AnalysisProtein glycosylation defects- Directly measures disease biomarker
- Multiple complementary methods
- Complex interpretation
- Requires specialized equipment
- Abnormal N- and O-glycosylation in VMA21-CDG
- Normal glycosylation in XMEA

What correlations exist between genotype, cellular phenotype, and clinical manifestations in VMA21-associated disorders?

VMA21 MutationMolecular ConsequenceCellular PhenotypeClinical ManifestationsDisease Classification
c.188A>G (p.Asn63Gly)- Moderately reduced protein level
- Strongly reduced mRNA
- Impaired interaction with V-ATPase components
- Reduced V₀ assembly
- Impaired lysosomal acidification
- Abnormal glycosylation
- Mild cholestasis
- Elevated aminotransferases
- Elevated LDL cholesterol
- Hepatic steatosis
VMA21-CDG
c.-10C>T- Strongly reduced protein level
- Strongly reduced mRNA
- Alternative start codon with premature stop
- Reduced V₀ assembly
- Impaired lysosomal acidification
- Abnormal glycosylation
- Similar liver manifestations as p.Asn63Gly
- Hypercholesterolemia
VMA21-CDG
p.Arg18Gly*- Strongly reduced protein level
- Strongly reduced mRNA
- Disrupted splicing with premature stop
- Reduced V₀ assembly
- Impaired lysosomal acidification
- Abnormal glycosylation
- Similar liver manifestations
- Hypercholesterolemia
VMA21-CDG
p.Gly91Ala- Mildly reduced protein level
- Mildly reduced mRNA
- Impaired interaction with V-ATPase components
- Reduced V₀ assembly
- Impaired lysosomal acidification
- Normal glycosylation
- Vacuolar myopathy
- Elevated CK (593 U/L)
- Subclinical liver involvement (elevated GGT, LDL cholesterol)
XMEA
*c.6A>G- Not specified in detail
- Likely affects mRNA stability
- Similar to other XMEA mutations
- Normal glycosylation
- Vacuolar myopathy
- Muscle-predominant symptoms
XMEA
c.164-7T>G- Not specified in detail
- Likely affects splicing
- Similar to other XMEA mutations
- Normal glycosylation
- Vacuolar myopathy
- Muscle-predominant symptoms
XMEA
vma21 zebrafish model- Complete loss of vma21 function- Impaired lysosomal acidification
- Reduced LAMP1 staining
- Increased LC3
- Reduced autophagic flux
- Abnormal morphology
- Impaired swimming
- Reduced survival
- Hepatic steatosis
- Smaller liver
- Impaired bile flux
Model system recapitulating both XMEA and CDG features

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.