Recombinant Bovine Vesicle-associated membrane protein 2 (VAMP2)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant bovine vesicle-associated membrane protein 2 (VAMP2), also known as synaptobrevin-2, is a key synaptic vesicle protein produced via recombinant DNA technology. It plays a critical role in neurotransmitter release by mediating membrane fusion through its participation in the SNARE (soluble N-ethylmaleimide-sensitive factor attachment protein receptor) complex . Bovine VAMP2 shares high sequence homology with human and rodent isoforms, making it a valuable tool for studying synaptic function, neurodegenerative diseases, and exocytosis mechanisms .

Production Methods

Recombinant bovine VAMP2 is typically expressed in Escherichia coli with purification tags (e.g., GST&His) for enhanced stability and solubility . Key specifications include:

ParameterDetails
Host organismE. coli
Molecular weight~45 kDa (predicted)
Purity>90% (SDS-PAGE)
Storage conditions-80°C in 20 mM Tris, 150 mM NaCl, pH 8.0, with 1 mM EDTA and 5% trehalose
ApplicationsWestern blot, immunohistochemistry, protein interaction assays

Role in Membrane Fusion

  • VAMP2 forms a SNARE complex with syntaxin-1A and SNAP-25, generating mechanical force for vesicle-plasma membrane fusion .

  • Mutations in the TMD (e.g., G100V) reduce hormone secretion by 70–90% in neuroendocrine cells .

Regulation of Fusion Dynamics

  • Cholesterol-rich microdomains modulate VAMP2 conformation and SNARE assembly .

  • Electrostatic interactions between the JMD and lipid membranes are essential for fusion efficiency .

Pathological Implications

  • Neurodevelopmental disorders: Heterozygous de novo VAMP2 mutations are linked to hypotonia, autism, and epilepsy .

  • Neurodegeneration: CSF VAMP2 levels correlate with Alzheimer’s disease biomarkers (e.g., tau) and cognitive decline .

Experimental Models

  • PC12 cells: VAMP2 knockdown reduces depolarization-evoked hormone secretion, rescued by recombinant WT VAMP2 but not TMD mutants .

  • INS-1 β-cells: Capacitance measurements show impaired exocytosis in cells expressing VAMP2-G100V/C103V .

Applications

  • Biochemical assays: Used in lipid-mixing experiments to study SNARE complex assembly .

  • Diagnostics: Quantified via digital immunoassays in CSF to monitor synaptic dysfunction in Alzheimer’s disease .

  • Therapeutic research: Targeted in studies on botulinum neurotoxins, which cleave VAMP2 to inhibit neurotransmitter release .

Challenges and Future Directions

  • Species-specific differences: Structural conservation enables cross-species studies, but functional variations (e.g., lipid binding) require validation .

  • Phase separation: Recent work links VAMP2 to α-synuclein condensates, suggesting roles in Parkinson’s disease .

  • Gene therapy: CRISPR-edited VAMP2 variants could address neurodevelopmental disorders caused by SNARE dysfunction .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have specific requirements for the format, please indicate them when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
VAMP2; SYB2; Vesicle-associated membrane protein 2; VAMP-2; Synaptobrevin-2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-116
Protein Length
Full Length of Mature Protein
Species
Bos taurus (Bovine)
Target Names
Target Protein Sequence
SATAATAPPAAPAGEGGPPAPPPNLTSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNLKMMIILGVICAIILIIIIVYFSS
Uniprot No.

Target Background

Function
VAMP2 plays a crucial role in the targeting and/or fusion of transport vesicles to their target membrane. It is a major SNARE protein of synaptic vesicles, mediating the fusion of synaptic vesicles to release neurotransmitters. VAMP2 is essential for fast vesicular exocytosis and activity-dependent neurotransmitter release, as well as fast endocytosis that enables rapid reuse of synaptic vesicles. Additionally, it modulates the gating characteristics of the delayed rectifier voltage-dependent potassium channel KCNB1.
Gene References Into Functions
  1. VAMP-2 is essential for lysosome fusion in membrane raft clustering. This VAMP-2-mediated lysosome-MR signalosome contributes to redox regulation of coronary endothelial function. PMID: 21926345
  2. VAMP2 is restricted from forming the SNARE (soluble N-ethylmaleimide-sensitive fusion protein attachment protein receptor) complex in chromaffin granules from adrenal medullae to the same degree as in brain-purified synaptic vesicles. PMID: 14563208
  3. Lengthening the juxtamembrane region of synaptobrevin-2 significantly reduces the occurrence of rapid single events, leaving slow ones unaffected. It also impairs the increase in fast-fusion mode that typically follows an elevation of intracellular Ca2+ levels. PMID: 18716205
Database Links
Protein Families
Synaptobrevin family
Subcellular Location
Cytoplasmic vesicle, secretory vesicle, synaptic vesicle membrane; Single-pass type IV membrane protein. Cell membrane.

Q&A

What is the molecular structure of VAMP2 and how does it contribute to membrane fusion?

VAMP2 (also known as synaptobrevin-2) is a small vesicle-associated membrane protein with four distinct structural domains that become stabilized upon interaction with other SNARE proteins. In its native state, VAMP2 is largely unstructured, but upon interaction with syntaxin-1A and SNAP-25, it forms an α-helical structure within the SNARE complex .

The protein's domains include:

  • N-terminal domain

  • SNARE motif (central region responsible for coiled-coil formation)

  • Transmembrane domain

  • Short C-terminal intravesicular tail

The SNARE motif is particularly important as it interacts with corresponding motifs in syntaxin-1A and SNAP-25 to form a stable four-helix bundle that drives membrane fusion. This "zippering" process generates the force necessary for bringing vesicle and plasma membranes close enough to fuse .

Methodologically, the study of VAMP2 structure has been approached through crystallography, NMR spectroscopy, and reconstituted liposome fusion assays that demonstrate how specific residues contribute to the fusion process.

What expression systems are most effective for producing functional recombinant bovine VAMP2?

Multiple expression systems have been successfully employed for VAMP2 production, each with distinct advantages depending on research objectives:

Expression SystemAdvantagesTypical YieldPurification MethodsApplications
E. coliHigh yield, economical, simple protocol>90% purityAffinity chromatography using His-tagSDS-PAGE, Western blot, ELISA
YeastPost-translational modifications, higher eukaryotic processing>90% purityAffinity purificationMembrane fusion assays
BaculovirusComplex folding, higher yield than mammalian>85% purityAffinity chromatographyElectrophysiology experiments
Mammalian cellsNative folding and modificationsVariable yieldsAffinity purificationInteraction studies

For recombinant bovine VAMP2 specifically, E. coli expression systems are most commonly reported, with amino acids 2-94 being the typically expressed fragment with a His-tag for purification, as shown in product ABIN1460035 . Researchers should consider including protease inhibitors during purification to prevent degradation of the recombinant protein.

How do mutations in the VAMP2 gene affect neurotransmitter release mechanisms?

Pathogenic variants in VAMP2 significantly impair neurotransmitter release by disrupting different aspects of vesicle fusion:

VAMP2 mutations have been shown to:

  • Decrease the rate of exocytosis

  • Reduce the number of vesicles released from the recycling pool

  • Diminish both spontaneous and evoked synaptic transmission

  • Impair the readily releasable pool (RRP) of vesicles

Electrophysiological recordings demonstrate that VAMP2 knockdown significantly reduces the frequency of spontaneous neurotransmitter release (measured as miniature excitatory and inhibitory postsynaptic currents) and strongly diminishes evoked postsynaptic current amplitudes .

A study of five patients with de novo VAMP2 pathogenic variants revealed a neurodevelopmental disorder characterized by global developmental delay, autistic tendencies, and behavioral disturbances . These clinical manifestations correlate with the critical role of VAMP2 in synaptic vesicle exocytosis.

Methodologically, mutations have been studied using:

  • Lentiviral-mediated expression of mutant proteins in neuronal cultures

  • Electrophysiological recordings to measure neurotransmission

  • Live cell imaging using pHluorin-tagged constructs to monitor vesicle exocytosis and recycling

What approaches can be used to study VAMP2's involvement in cargo-selective vesicular transport?

Recent research has revealed that VAMP2 serves as a cargo-selective v-SNARE in certain contexts, as demonstrated in a study of μ-opioid receptor (MOR) recycling . Methodological approaches to study this selectivity include:

  • Inducible knockdown systems: Using doxycycline-inducible shRNA constructs targeting VAMP2 to assess its specific role in trafficking of different cargo proteins .

  • Live-cell imaging techniques:

    • Super-resolution microscopy to visualize VAMP2-containing vesicles

    • pH-sensitive protein tags (e.g., pHluorin, pHuji) fused to cargo proteins to monitor recycling events in real-time

    • Dual-color imaging to track co-localization of VAMP2 with specific cargo

  • Computational analysis of fusion events:

    • Gaussian mixture modeling of fusion event populations

    • Analysis using scikit-learn in Python to classify distinct vesicle fusion populations

For example, researchers studying MOR recycling utilized:

  • Doxycycline-inducible shRNA backbone (pLKO-tagBFP-TetOn)

  • VAMP2 shRNA targeting sequence: 5′-CCGGAACAAGTGCAGCCAAGCTCAACTCGAGTTGAGCTTGGCTGCACTTGTTTTTTTG-3′

  • Quantification of knockdown efficiency through integrated density of VAMP2 immunostaining

This methodology revealed that VAMP2 is specifically required for MOR recycling but not for β2-adrenergic receptor recycling, suggesting cargo selectivity at the suborganellar level.

How can aminopyridines be used to overcome presynaptic defects caused by VAMP2 mutations?

Research has shown that aminopyridine treatment may provide a therapeutic strategy for overcoming presynaptic defects caused by VAMP2 mutations . This approach works by:

  • Mechanism of action: Aminopyridines (4-aminopyridine and 3,4-diaminopyridine) inhibit potassium channels, prolonging action potentials and delaying neuronal repolarization, which increases calcium entry and synaptic vesicle release probability .

  • In vitro effects on VAMP2 mutant neurons:

    • Increased rate and extent of exocytosis

    • Enhanced total synaptic charge transfer

    • Desynchronization of GABA release, potentially compensating for inhibitory deficits

  • Clinical application: A patient with a de novo stop-gain VAMP2 mutation (R56X) showed improved emotional and behavioral regulation after two years of off-label aminopyridine treatment, with objective improvement in standardized cognitive measures .

  • Experimental design for testing aminopyridine effects:

    • Generate lentiviral constructs expressing wild-type or mutant VAMP2 (e.g., R56L, G73W, or R56X)

    • Transfect primary neuronal cultures and perform live-cell imaging using synaptophysin-pHluorin to monitor vesicle exocytosis

    • Conduct electrophysiological recordings to measure synaptic transmission with and without aminopyridine treatment

This pharmacological approach demonstrates that enhancing action potential-driven calcium influx can potentially compensate for defects in the release machinery caused by VAMP2 mutations, suggesting broader applications for other presynaptic disorders.

What are the most reliable methods for knocking down VAMP2 expression in primary cell cultures?

Based on the provided research articles, several approaches have been validated for effective VAMP2 knockdown:

  • Adenoviral-mediated shRNA delivery:

    • Adenovector-pMIGHTY backbone with inserted shRNA sequence

    • Typical knockdown efficiency: ~54-67% reduction in VAMP2 protein levels

    • Example sequence: 5′-GCTCAAGCGCAAATACTGG-3′ followed by loop region (TTCAAGAGA) and antisense fragment

    • Optimal conditions: 100 plaque-forming units/cell for 3 hours in serum-free media, followed by addition of serum to 5% final concentration

  • Lentiviral-mediated shRNA expression:

    • pLKO-tagBFP-TetOn inducible system

    • Doxycycline-induction (200 ng/ml for 48h)

    • Example sequence: 5′-CCGGAACAAGTGCAGCCAAGCTCAACTCGAGTTGAGCTTGGCTGCACTTGTTTTTTTG-3′

    • Knockdown efficiency assessment: integrated density of VAMP2 immunostaining over uniform threshold

  • Verification of knockdown efficiency:

    • Western blotting with anti-VAMP2 antibodies (commonly at 1:1000-1:2000 dilution)

    • Immunofluorescence with confocal microscopy

    • Functional assays (e.g., measuring secretion of cell-specific products)

When implementing these methods, researchers should include appropriate controls:

  • Non-targeting shRNA sequences (scrambled)

  • Internal loading controls for protein quantification (e.g., actin)

  • Verification of specificity by testing effects on related proteins (e.g., VAMP3)

How does VAMP2 interact with other proteins in the presynaptic compartment beyond the core SNARE complex?

Beyond its well-established role in the SNARE complex, VAMP2 interacts with several other presynaptic proteins that regulate various aspects of vesicle trafficking and fusion:

  • α-Synuclein (α-Syn): Interacts with VAMP2 and can influence SNARE complex assembly, with implications for neurodegenerative diseases like Parkinson's disease .

  • Synaptophysin (SYP): Forms a distinct complex with VAMP2 that may regulate VAMP2 availability for SNARE complex formation and vesicle recycling .

  • SM proteins (Sec1/Munc18-like proteins): Interact with VAMP2 to facilitate SNARE complex assembly and regulate the fusion process .

  • Ion channel proteins: VAMP2 has been shown to modulate the gating characteristics of the delayed rectifier voltage-dependent potassium channel KCNB1 .

  • Synaptotagmin-1: Functions as the main Ca²⁺ sensor and signals to the SNARE complex (including VAMP2) to initiate membrane fusion upon calcium influx .

  • Complexins: Regulate SNARE-mediated fusion through interactions with the VAMP2-containing SNARE complex .

Research methodologies to study these interactions include:

  • Co-immunoprecipitation assays

  • FRET-based interaction studies

  • Reconstituted liposome fusion assays

  • Electrophysiological recordings in the presence of specific interaction inhibitors

Understanding these interactions is crucial for developing targeted approaches to modulate neurotransmission in disorders associated with synaptic dysfunction.

What are the differences in VAMP2 function between neuronal and non-neuronal secretory systems?

While VAMP2 is primarily known for its role in neuronal synaptic transmission, it also functions in non-neuronal secretory systems with some important differences:

FeatureNeuronal SystemNon-Neuronal System (e.g., JG cells)
Primary roleFast neurotransmitter releaseRegulated secretion (e.g., renin release)
Speed of exocytosisMillisecond timescaleGenerally slower (seconds to minutes)
Calcium dependenceHighly Ca²⁺-dependentVariable Ca²⁺ dependence
Response to cAMPModulatory roleDirect stimulation of secretion
Redundancy with other VAMPsLimited redundancyPossible redundancy with VAMP3, VAMP7, or VAMP8

In juxtaglomerular (JG) cells, VAMP2 (but not VAMP3) mediates cAMP-stimulated renin release, as demonstrated through specific knockdown experiments . When VAMP2 was knocked down by ~54% using shRNA, cAMP-stimulated renin release was significantly impaired by ~67%, while VAMP3 knockdown had no effect .

Methodology for studying VAMP2 in non-neuronal systems includes:

  • Specific protein knockdown using viral vectors

  • Measurement of secreted products (e.g., renin)

  • Immunofluorescence and confocal microscopy to visualize co-localization with secretory granules

  • Western blotting to quantify protein expression levels

These comparative studies suggest that while VAMP2's fundamental function in membrane fusion is conserved across cell types, its regulation and interaction partners may differ significantly between neuronal and non-neuronal contexts.

What quality control parameters should be assessed when validating recombinant VAMP2 for functional studies?

To ensure that recombinant VAMP2 is suitable for functional studies, researchers should assess several key quality control parameters:

  • Purity assessment:

    • SDS-PAGE analysis (>85-95% purity is typically required)

    • Silver staining for highly sensitive detection of contaminants

    • Western blotting to confirm identity

  • Structural integrity:

    • Circular dichroism to assess secondary structure

    • Size exclusion chromatography to detect aggregation

    • Mass spectrometry to confirm molecular weight and detect modifications

  • Functional validation:

    • SNARE complex formation assay with recombinant syntaxin-1A and SNAP-25

    • Liposome fusion assays to confirm fusogenic activity

    • Binding assays with known interaction partners (e.g., synaptophysin)

  • Stability assessment:

    • Thermal stability testing (e.g., accelerated degradation at 37°C for 48h)

    • Freeze-thaw stability over multiple cycles

    • Long-term storage stability at different temperatures (e.g., 2-8°C vs. -80°C)

For recombinant bovine VAMP2 (amino acids 2-94), a recommended storage buffer composition is:

  • 20mM Tris

  • 150mM NaCl

  • pH 8.0

  • 1mM EDTA

  • 1mM DTT

  • 0.01% SKL

  • 5% Trehalose

  • Protease inhibitors

The loss rate during storage should be less than 5% within the expiration date under appropriate conditions, and no obvious degradation or precipitation should be observed during stability testing .

How can recombinant VAMP2 be effectively used in assays to screen potential therapeutics for VAMP2-related disorders?

Recombinant VAMP2 can serve as a valuable tool for screening potential therapeutics for disorders associated with VAMP2 dysfunction:

  • In vitro SNARE complex assembly assays:

    • Mix recombinant VAMP2 with syntaxin-1A and SNAP-25

    • Monitor complex formation kinetics by fluorescence or FRET

    • Test compounds that may enhance assembly in the presence of mutant VAMP2 proteins

  • Reconstituted vesicle fusion assays:

    • Incorporate wild-type or mutant VAMP2 into donor liposomes

    • Include syntaxin-1A and SNAP-25 in acceptor liposomes

    • Measure fusion using lipid mixing or content mixing assays

    • Evaluate therapeutic compounds that enhance fusion rates

  • Cell-based assay systems:

    • Express VAMP2 mutations in primary neuronal cultures

    • Monitor neurotransmitter release using FM dyes or pHluorin-based sensors

    • Assess drug effects on exocytosis and endocytosis defects

  • Electrophysiological screening:

    • Record spontaneous and evoked postsynaptic currents in neurons expressing VAMP2 mutations

    • Test compounds such as aminopyridines that may overcome release deficits

    • Quantify changes in miniature postsynaptic current frequency and amplitude

A successful application of this approach was demonstrated with aminopyridine treatment, which increased the rate and extent of exocytosis in neurons expressing pathogenic VAMP2 variants . This suggests that enhancing calcium influx can partially compensate for VAMP2 dysfunction.

For high-throughput screening, recombinant VAMP2 can be immobilized on biosensor chips to screen for small molecules that stabilize interactions with other SNARE proteins or prevent pathological interactions with proteins like α-synuclein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.