Recombinant Bovine Vesicle-associated membrane protein-associated protein B (VAPB)

Shipped with Ice Packs
In Stock

Description

ER-Mitochondria Tethering

Recombinant VAPB interacts with mitochondrial protein PTPIP51 to regulate ER-mitochondria contact sites, critical for:

  • Calcium signaling

  • Lipid transfer

  • Mitochondrial membrane expansion

Mechanism:

  • FFAT-like motifs in binding partners (e.g., ACBD5, IRS-1) dock onto VAPB’s MSP domain .

  • ALS-linked P56S mutation disrupts MSP domain function, impairing ER-mitochondria associations .

Role in Insulin Signaling

Recombinant VAPB stabilizes IRS-1 signalosomes via ER-targeted phase separation:

  • Binds IRS-1 residues Y745/Y746 in FFAT-like motifs .

  • Knockout models show reduced IRS-1 stability and glucose intolerance .

Amyotrophic Lateral Sclerosis (ALS8)

  • P56S Mutant VAPB: Forms intracellular aggregates, sequesters wild-type VAPB, and induces ER-stress-mediated motor neuron death .

  • Pathogenic Effects:

    • Disrupted Golgi trafficking

    • Impaired mitochondrial biogenesis

    • Reduced PTPIP51 binding capacity

Viral Propagation Studies

  • Wild-type VAPB supports hepatitis C virus (HCV) replication, while truncated isoform VAP-C inhibits it .

Research Limitations and Future Directions

  • Challenges: Lack of post-translational modifications in prokaryotic systems may limit functional studies .

  • Opportunities: Use mammalian expression systems to study glycosylation impacts or develop disease models using P56S mutants .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timeframes.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
Tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
VAPB; Vesicle-associated membrane protein-associated protein B; VAMP-B; VAMP-associated protein B; VAP-B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-243
Protein Length
Full Length of Mature Protein
Species
Bos taurus (Bovine)
Target Names
Target Protein Sequence
AKVEQVLSLEPQHELKFRGPFTDVVTTNLKLGNPTDRNVCFKVKTTAPRRYCVRPNSGIIDAGASINVSVMLQPFDYDPNEKSKHKFMVQSMFAPTDTSDMEAVWKEAKPEDLMDSKLRCVFELPAENDKPHDVEINKIIPTTASKTETPTVSKALSSSLDDTEVKKVMEECKRLQSEVQRLREENKQFKEEDGLRMRKTAQSNSPAPASAMAGKEEGLSTRLLALVVLFFIVGVIIGKIAL
Uniprot No.

Target Background

Function
VAPB participates in the endoplasmic reticulum unfolded protein response (UPR) by inducing ERN1/IRE1 activity. It is involved in regulating cellular calcium homeostasis.
Database Links
Protein Families
VAMP-associated protein (VAP) (TC 9.B.17) family
Subcellular Location
Endoplasmic reticulum membrane; Single-pass type IV membrane protein.

Q&A

What is the structure and function of bovine VAPB?

Bovine VAPB is a ~30 kDa ubiquitously expressed type IV transmembrane protein belonging to the VAP family. The protein contains a major sperm protein (MSP) domain (approximately amino acids 7-124), a coiled-coil region (approximately amino acids 159-196), and a 21 amino acid C-terminal membrane anchor. The cytoplasmic domain comprises approximately 222 amino acids of the total 243 amino acid sequence .

Functionally, VAPB localizes primarily to the endoplasmic reticulum (ER), Golgi apparatus, and other intracellular membranes. It exists as either a homodimer or as a heterodimer with VAPA, with dimerization likely occurring through a GxxxG motif in the transmembrane regions. The primary functions of VAPB include recruiting FFAT (two phenylalanines in an acidic tract)-motif-containing proteins to the cytosolic surface of ER membranes, regulating membrane transport, participating in phospholipid biosynthesis, organizing microtubules, and mediating the unfolded protein response .

Human VAPB shares 94% amino acid identity with porcine VAPB and 96% with bovine VAPB, suggesting high conservation of structure and function across mammalian species .

What methods are recommended for detecting recombinant bovine VAPB in experimental systems?

For detecting recombinant bovine VAPB in experimental systems, multiple approaches can be employed:

  • Immunoblotting (Western blot): Use anti-VAPB antibodies such as those developed against human VAPB, which typically show cross-reactivity with bovine VAPB due to high sequence homology. Commercial antibodies like MAB5855 demonstrate approximately 50% cross-reactivity with rat VAP-B while showing no cross-reactivity with VAP-A .

  • Immunofluorescence microscopy: For cellular localization studies, fix and permeabilize cells using standard protocols, then probe with anti-VAPB primary antibodies followed by fluorophore-conjugated secondary antibodies. This method allows visualization of VAPB's subcellular distribution, particularly its association with ER membranes .

  • Immunohistochemistry: For tissue samples, use paraffin-embedded sections with antibodies such as Mouse Anti-Human VAP-B Monoclonal Antibody (e.g., MAB5855) at 15 μg/mL overnight at 4°C, followed by HRP-DAB staining. This approach has successfully visualized VAPB in neuronal cell bodies in human brain cerebellum sections .

  • Proximity ligation assay (PLA): This technique can detect VAPB interactions with binding partners (e.g., PTPIP51) using antibody pairs. The assay generates fluorescent signals when protein pairs are within 50 nm of each other, providing evidence of protein-protein interactions in intact cells .

How can I purify recombinant bovine VAPB protein for experimental use?

Purification of recombinant bovine VAPB can be achieved using established protocols for bacterial expression systems:

  • Expression system: Clone the bovine VAPB cDNA into a prokaryotic expression vector containing a His-tag or other affinity tag. Express the protein in Rosetta bacteria or other E. coli strains optimized for mammalian protein expression .

  • Protein induction: Induce protein expression using IPTG at appropriate concentrations and temperature conditions (typically 0.5-1 mM IPTG at 18-30°C) for 4-18 hours .

  • Affinity purification: For His-tagged VAPB, lyse bacteria and purify using nickel beads (e.g., from Qiagen) according to the manufacturer's protocol. Elute the protein using imidazole gradient buffers .

  • Concentration: Concentrate the purified protein using devices such as Centricon (Bio-Rad) to achieve desired concentration for downstream applications .

  • Quality control: Verify protein purity by SDS-PAGE and identity by Western blotting using anti-VAPB antibodies. Assess protein folding using circular dichroism if structural integrity is critical for your application.

For immunization purposes, the purified protein can be injected into rabbits in a suspension of adjuvant (e.g., TiterMax Gold) to generate polyclonal antibodies with specificity for different domains of the protein .

How should I design experiments to study VAPB-mediated ER-mitochondria tethering?

To investigate VAPB-mediated ER-mitochondria tethering, consider the following experimental design approaches:

  • Biochemical fractionation: Isolate mitochondria-associated membranes (MAM) using Percoll gradient centrifugation. Analyze fractions by immunoblotting for VAPB alongside established markers: PTPIP51 and HSP60 as mitochondrial markers, FACL4 as a MAM marker, and PDI as a general ER marker. This approach can confirm VAPB enrichment in MAM fractions .

  • Modulation of PTPIP51 expression: Since PTPIP51 is an outer mitochondrial membrane protein that interacts with VAPB, manipulate its expression using:

    • Overexpression: Transfect cells with HA-PTPIP51 expression constructs

    • Knockdown: Use PTPIP51-specific siRNAs (aim for >90% knockdown efficiency)

    Monitor how these manipulations affect VAPB association with mitochondria by isolating a biochemical fraction containing both mitochondria and MAM but not ER, then quantifying VAPB content by immunoblotting .

  • Proximity ligation assay (PLA): Use antibodies against VAPB and PTPIP51 in fixed and permeabilized cells, followed by secondary antibodies coupled to oligonucleotides. When the proteins are within 50 nm, the oligonucleotides can hybridize and serve as primers for rolling-circle amplification with fluorescent oligonucleotides, generating signals that can be quantified by fluorescence microscopy .

  • Mutational analysis: Introduce mutations in the VAPB MSP domain that might affect interaction with PTPIP51 or other tethering partners. The P56S mutation, associated with ALS, can serve as a comparative model for disrupted tethering .

  • Live-cell imaging: Use fluorescently tagged VAPB and mitochondrial markers to visualize tethering dynamics in real-time, particularly in response to cellular stressors or signaling events.

What experimental design would you recommend for analyzing the VAPB-IRS-1 interaction and its impact on insulin signaling?

To analyze the VAPB-IRS-1 interaction and its impact on insulin signaling, implement the following comprehensive experimental design:

  • Interaction domain mapping:

    • Create a series of truncation mutants of both VAPB and IRS-1

    • The MSP domain of VAPB (amino acids 7-124) is critical for most protein interactions

    • For IRS-1, focus on the region between amino acids 601-800, which contains FFAT-like motifs

    • Create specific point mutations in potential interaction sites, such as converting tyrosine residues 745 and 746 to alanine (IRS-1-2YA) or phenylalanine 766 to alanine in IRS-1

    • Perform co-immunoprecipitation assays to determine which domains and specific residues are essential for the interaction

  • In vitro binding assays:

    • Express and purify recombinant VAPB and IRS-1 proteins from E. coli

    • Conduct direct binding assays to confirm that the interaction is direct rather than mediated by other proteins

    • Use techniques such as surface plasmon resonance or isothermal titration calorimetry to determine binding kinetics and affinity

  • Cellular localization studies:

    • Use immunofluorescence microscopy to visualize the co-localization of VAPB and IRS-1

    • Employ super-resolution microscopy techniques to examine their precise spatial arrangement at the ER

    • Analyze how insulin stimulation affects this co-localization

    • Compare wild-type proteins to interaction-deficient mutants

  • Functional analysis:

    • Create VAPB knockout cell lines using CRISPR/Cas9

    • Reconstitute these lines with either wild-type VAPB or interaction-deficient mutants

    • Measure insulin signaling outputs, including Akt phosphorylation, glucose uptake, and glycogen synthesis

    • Analyze IRS-1 stability and phosphorylation status in the presence or absence of VAPB

    • Examine the formation and stability of IRS-1 signalosomes using phase separation assays

  • In vivo studies:

    • Analyze glucose homeostasis in VAPB knockout mice

    • Measure insulin sensitivity using glucose and insulin tolerance tests

    • Examine tissue-specific effects by analyzing insulin signaling in liver, muscle, and adipose tissues

    • Consider the use of tissue-specific conditional knockout models to distinguish primary from secondary effects

This experimental design systematically dissects both the molecular basis and functional significance of the VAPB-IRS-1 interaction in insulin signaling.

What are the recommended methods for detecting and characterizing VAPB aggregates in ALS research models?

For detecting and characterizing VAPB aggregates in ALS research models, employ the following methodological approaches:

  • Immunofluorescence analysis (IFA):

    • Fix cells or tissue sections using 4% paraformaldehyde

    • Permeabilize with 0.1% Triton X-100

    • Block with appropriate serum (5-10%)

    • Incubate with anti-VAPB primary antibodies

    • Detect using fluorophore-conjugated secondary antibodies

    • Counterstain with DAPI for nuclear visualization

    • Analyze using confocal microscopy to identify aggregate patterns

    This approach has revealed distinctive VAPB aggregate patterns in sporadic ALS (sALS) patient-derived peripheral blood mononuclear cells (PBMCs) that are not observed in healthy controls or Parkinson's disease patients .

  • Flow cytometry assay (FCA):

    • Prepare single-cell suspensions from cultures or tissue samples

    • Fix and permeabilize cells

    • Stain with fluorescently labeled anti-VAPB antibodies

    • Analyze using flow cytometry to quantify VAPB signal intensity

    This method can indirectly confirm protein misfolding by demonstrating reduced VAPB fluorescent signals in ALS samples compared to controls .

  • Biochemical fractionation:

    • Separate soluble and insoluble protein fractions using detergents of increasing strength

    • Analyze fractions by SDS-PAGE and immunoblotting with anti-VAPB antibodies

    • Compare the distribution of VAPB between soluble and insoluble fractions in disease versus control samples

  • Co-localization studies:

    • Perform double immunostaining for VAPB and ER markers (e.g., calreticulin, BiP/GRP78)

    • Assess co-localization with stress granule markers or autophagy markers like LC3

    • Quantify the degree of co-localization using appropriate software

  • Electron microscopy:

    • Process samples for immunogold labeling with anti-VAPB antibodies

    • Analyze the ultrastructural characteristics of VAPB-positive aggregates

    • Examine associated ER membrane reorganization

  • Live-cell imaging:

    • Express fluorescently tagged VAPB (wild-type or P56S mutant)

    • Monitor aggregate formation in real-time

    • Assess the impact of potential therapeutic compounds on aggregate dynamics

When implementing these methods, it's important to note that the P56S mutation in VAPB leads to formation of ER-associated aggregates that cause complete reorganization of ER structures. This can serve as a positive control for aggregate detection methods .

What expression vectors and systems are optimal for producing recombinant bovine VAPB?

For optimal production of recombinant bovine VAPB, consider the following expression vectors and systems:

  • Bacterial expression systems:

    • Vectors: pET series vectors (particularly pET28a for His-tagged proteins) are effective for producing VAPB or its domains, especially the MSP domain

    • Host strains: Rosetta bacteria have been successfully used for VAP protein expression, as they supply tRNAs for codons rarely used in E. coli but common in mammalian genes

    • Purification strategy: Include His-tags for purification using nickel beads (Qiagen), following manufacturer's protocols

    • Applications: This approach is suitable for producing protein for structural studies, antibody generation, and in vitro binding assays

  • Mammalian expression systems:

    • Vectors: pGW1-expression vectors with HA- or myc-tags have been successfully used for VAP protein expression in mammalian cells

    • Construction approach: Generate full-length constructs by PCR using template cDNAs such as IMAGE clones

    • Mutagenesis: Site-directed mutagenesis can be employed to generate specific mutants (e.g., P56S, K87D, and M89D mutations) for comparative studies

    • Transfection: Lipofectamine-2000 (Invitrogen) has been used successfully for transfection of VAPB constructs

    • Applications: This system is ideal for cellular localization studies, protein-protein interaction analyses, and functional assays

  • Biotin-tagging system:

    • Components: Co-express biotin-tagged VAPB constructs with the protein-biotin ligase BirA

    • Advantage: Allows for biotinylation of VAPB in vivo, facilitating highly specific pull-down assays using streptavidin

    • Applications: Particularly useful for identifying interaction partners of VAPB in cellular contexts

  • Fluorescent fusion proteins:

    • Vectors: Constructs encoding VAPB fused to GFP, YFP, or other fluorescent proteins

    • Applications: Enable visualization of VAPB localization and dynamics in living cells

    • Controls: Include other fluorescently tagged proteins such as tsVSVG-YFP and ORP3-GFP as controls or markers for specific cellular compartments

When designing expression constructs, consider the domain structure of VAPB:

  • Full-length constructs should include all 243 amino acids

  • The MSP domain (amino acids 7-124) can be expressed separately for domain-specific studies

  • The C-terminal transmembrane domain may affect solubility in bacterial systems and might require detergent solubilization

What antibodies and detection systems are most effective for studying bovine VAPB?

For studying bovine VAPB, the following antibodies and detection systems have proven effective:

  • Primary antibodies:

    • Polyclonal antibodies: Custom-generated rabbit antibodies against different domains of VAPB show good specificity and can be used for various applications:

      • Antibodies against full-length VAPB (amino acids 1-225)

      • Antibodies against the C-terminal domain (amino acids 132-225)

      • These can be purified using cyanogen bromide-activated Sepharose 4B-columns coupled to His-tagged fusion proteins

    • Monoclonal antibodies: Commercial antibodies like MAB5855 (Mouse Anti-Human VAP-B) show approximately 50% cross-reactivity with rodent VAP-B and would likely recognize bovine VAPB due to high sequence homology (96% identity between human and bovine VAPB)

  • Detection systems:

    • Immunofluorescence:

      • Secondary antibodies: Species-appropriate fluorophore-conjugated antibodies

      • Confocal microscopy for high-resolution imaging of subcellular localization

      • Super-resolution microscopy techniques (STED, PALM, or STORM) for detailed analysis of VAPB distribution at membrane contact sites

    • Immunohistochemistry:

      • HRP-DAB Cell & Tissue Staining Kit for chromogenic detection

      • Counterstaining with hematoxylin for tissue context

      • This approach has successfully detected VAPB in neuronal cell bodies in human brain cerebellum sections

    • Immunoblotting:

      • Enhanced chemiluminescence (ECL) detection systems

      • Fluorescent secondary antibodies for quantitative Western blotting

      • Load appropriate controls: VAPA to assess specificity, housekeeping proteins for loading control

  • Specialized detection methods:

    • Proximity Ligation Assay (PLA):

      • Detects protein-protein interactions when proteins are within 50 nm

      • Uses antibody pairs (e.g., anti-VAPB and anti-PTPIP51) coupled to oligonucleotides

      • Generates fluorescent signals through rolling-circle amplification when proteins interact

      • Allows visualization and quantification of VAPB interactions in intact cells

    • Flow Cytometry:

      • Can assess VAPB expression levels in cell populations

      • Particularly useful for detecting alterations in VAPB conformation or expression

      • Has been used to identify reduced VAPB signals in cells from ALS patients

  • Controls and validation:

    • Specificity controls: Include VAPB knockout samples or siRNA-treated cells

    • Cross-reactivity assessment: Test for cross-reactivity with VAPA, which shares structural similarity with VAPB

    • Positive controls: Include samples with overexpressed VAPB

    • Negative controls: Omit primary antibody to assess background staining

What are common challenges in working with recombinant VAPB and how can they be addressed?

Researchers working with recombinant VAPB often encounter several technical challenges. Here are the most common issues and recommended solutions:

  • Protein solubility and aggregation issues:

    • Challenge: As a transmembrane protein, full-length VAPB can form aggregates during recombinant expression and purification.

    • Solutions:

      • Express only the soluble domains (MSP domain, amino acids 7-124) for structural and interaction studies

      • Use mild detergents (0.1% DDM or 1% CHAPS) when working with full-length protein

      • Add 5-10% glycerol to purification buffers to enhance stability

      • Purify at 4°C and avoid freeze-thaw cycles

      • Consider fusion tags that enhance solubility (MBP, SUMO, or thioredoxin)

  • Expression level variations:

    • Challenge: Inconsistent expression levels between experiments.

    • Solutions:

      • Optimize induction conditions (IPTG concentration, temperature, duration)

      • Screen multiple bacterial clones to identify high expressers

      • For mammalian expression, use transfection reagents optimized for your cell type

      • Consider stable cell lines for consistent expression levels

  • Antibody cross-reactivity:

    • Challenge: Cross-reactivity between VAPB and the closely related VAPA.

    • Solutions:

      • Use antibodies specific to unique regions of VAPB

      • Validate antibody specificity using VAPB knockout or knockdown samples

      • Include appropriate controls (e.g., VAPA-only samples)

      • Commercial antibody MAB5855 shows no cross-reactivity with recombinant human VAP-A

  • P56S mutant aggregation:

    • Challenge: The ALS-associated P56S mutant forms aggregates, complicating functional studies.

    • Solutions:

      • Use lower expression levels to minimize aggregation

      • Consider inducible expression systems to control timing and level of expression

      • For microscopy, co-express with ER markers to visualize ER reorganization

      • Include wild-type VAPB as a control in all experiments

  • Interaction detection sensitivity:

    • Challenge: Detecting transient or weak interactions between VAPB and partner proteins.

    • Solutions:

      • Use proximity ligation assays for detecting interactions in intact cells

      • Consider chemical crosslinking before immunoprecipitation

      • Apply techniques like FRET or BiFC for studying interactions in living cells

      • Use the biotin-streptavidin system for highly specific pull-down assays

  • Subcellular fractionation purity:

    • Challenge: Obtaining pure MAM fractions for studying VAPB at ER-mitochondria contact sites.

    • Solutions:

      • Optimize Percoll gradient centrifugation parameters

      • Verify fraction purity using established markers:

        • PTPIP51 and HSP60 for mitochondria

        • FACL4 for MAM

        • PDI for general ER

How can I optimize experimental conditions when comparing wild-type and mutant VAPB function?

When comparing wild-type and mutant VAPB function, optimization of experimental conditions is crucial for generating reliable and interpretable results. Here's a comprehensive approach to experimental optimization:

  • Expression level control:

    • Challenge: The P56S mutant tends to aggregate, potentially causing artifacts at high expression levels.

    • Optimization strategies:

      • Use inducible expression systems to titrate protein levels

      • Ensure equivalent expression levels between wild-type and mutant constructs

      • Quantify protein expression by Western blot before functional assays

      • Consider using fluorescent tags with known correlation between fluorescence intensity and protein amount

  • Cellular model selection:

    • Challenge: Different cell types may show variable sensitivity to VAPB perturbations.

    • Optimization strategies:

      • Test multiple cell lines relevant to VAPB biology (e.g., neuronal cells for ALS studies)

      • Compare primary cells to cell lines when possible

      • Consider using patient-derived cells with endogenous mutations

      • For comprehensive analysis, include both overexpression and knockout/knockdown approaches

  • Time course considerations:

    • Challenge: VAPB-mediated effects may develop over different timeframes.

    • Optimization strategies:

      • Conduct time-course experiments following transfection/induction

      • Monitor aggregate formation kinetics for mutant VAPB

      • Assess acute vs. chronic effects of VAPB perturbation

      • For ER stress responses, test multiple time points as the unfolded protein response occurs in phases

  • Functional assay selection:

    • Challenge: VAPB affects multiple cellular processes, requiring diverse assays.

    • Optimization strategies:

      • ER-mitochondria tethering: Use proximity ligation assays and quantitative microscopy

      • ER stress: Monitor BiP/GRP78 expression, XBP1 splicing, and PERK phosphorylation

      • Membrane transport: Assess trafficking of reporter proteins like tsVSVG-YFP

      • Protein-protein interactions: Compare interaction profiles using immunoprecipitation or proximity-based assays

  • Experimental design for mutational analysis:

    • Challenge: Distinguishing specific effects of the P56S mutation from general disruption of protein function.

    • Optimization strategies:

      • Include additional mutants affecting different domains (e.g., K87D, M89D)

      • Create structure-based mutations affecting specific interactions

      • Use domain deletion constructs to identify functional regions

      • Compare naturally occurring variants to engineered mutations

  • Data normalization and statistical analysis:

    • Challenge: Variability between experiments can mask true biological effects.

    • Optimization strategies:

      • Implement appropriate internal controls for normalization

      • Use sufficient biological and technical replicates (minimum n=3)

      • Apply appropriate statistical tests based on data distribution

      • Consider using factorial experimental designs to assess multiple variables simultaneously

  • Accounting for dimerization effects:

    • Challenge: VAPB forms homo- and heterodimers, complicating mutant analysis.

    • Optimization strategies:

      • Express mutants in VAPB knockout backgrounds to prevent dimerization with endogenous protein

      • Create forced dimer constructs to control stoichiometry

      • Use proximity-based assays to assess wild-type/mutant dimerization in cells

      • Evaluate whether mutants exert dominant-negative effects on wild-type protein

How can recombinant bovine VAPB be used to study neurodegenerative disease mechanisms?

Recombinant bovine VAPB offers valuable insights into neurodegenerative disease mechanisms, particularly ALS, through the following research applications:

  • Comparative studies of wild-type and P56S mutant VAPB:

    • Express and purify both wild-type bovine VAPB and a P56S mutant (equivalent to the human ALS-associated mutation)

    • Compare biochemical properties, including protein folding, stability, and aggregation propensity

    • Assess the impact on protein-protein interactions, particularly with FFAT-motif proteins

    • Use structural studies (X-ray crystallography, NMR) to understand how the mutation alters protein conformation

  • ER stress and unfolded protein response (UPR) investigations:

    • Use cell culture models expressing wild-type or mutant VAPB to study ER stress markers

    • Monitor changes in BiP/GRP78, calreticulin, and other ER chaperones

    • Assess activation of UPR signaling pathways via PERK, IRE1, and ATF6

    • Evaluate how VAPB aggregates influence ER morphology and function in neuronal cells

    • These studies are particularly relevant as the P56S mutation produces non-functional protein that forms intracellular aggregates and increases ER-stress-induced death of motor neurons

  • ER-mitochondria communication:

    • Investigate how VAPB mediates ER-mitochondria tethering via interaction with PTPIP51

    • Assess how the P56S mutation affects this tethering function

    • Study calcium signaling between these organelles in the context of neurodegeneration

    • Evaluate mitochondrial function (membrane potential, respiration, fission/fusion) in cells expressing mutant VAPB

    • This approach is supported by evidence that VAPB is present in mitochondria-associated membranes (MAM) and interacts with the outer mitochondrial membrane protein PTPIP51

  • Biomarker development:

    • Assess whether VAPB aggregates can serve as diagnostic or prognostic biomarkers for ALS

    • Compare VAPB aggregate patterns between sporadic ALS and familial ALS cases

    • Evaluate VAPB as a potential biomarker in peripheral blood mononuclear cells (PBMCs)

    • Develop assays to detect misfolded VAPB in patient samples

    • This application builds on findings that VAPB aggregates in PBMCs show a specific pattern in sporadic ALS patients that is not present in healthy controls or Parkinson's disease patients

  • Therapeutic target identification:

    • Screen for compounds that prevent VAPB aggregation or restore function of mutant VAPB

    • Identify small molecules that enhance ER-mitochondria tethering to compensate for VAPB dysfunction

    • Develop strategies to modulate VAPB-dependent pathways to reduce neuronal vulnerability

    • Test whether overexpression of wild-type VAPB can rescue cellular defects associated with the P56S mutation

  • Cross-species comparative studies:

    • Compare bovine, human, and rodent VAPB to identify conserved and divergent features

    • Assess whether species differences affect vulnerability to aggregation or mutation effects

    • Use insights from bovine VAPB to inform and refine rodent models of ALS

    • This approach leverages the high sequence conservation of VAPB across species (bovine VAPB shares 96% amino acid identity with human VAPB)

What are the emerging research directions for VAPB in cellular signaling beyond neurodegeneration?

Beyond neurodegeneration, VAPB plays crucial roles in various cellular signaling pathways, offering exciting opportunities for research in multiple fields:

  • VAPB in insulin/IGF signaling regulation:

    • Recent research has identified a novel role for VAPB in stabilizing IRS-1 signalosomes at the ER

    • VAPB interacts with IRS-1 through its MSP domain, with IRS-1 amino acids 601-800 being required for this association

    • Two potential FFAT-like motifs within this region mediate binding, particularly involving tyrosine residues 745, 746, and phenylalanine 766

    • Knockout of VAPB leads to reduced IRS-1 expression, impaired insulin signaling, and aberrant glucose homeostasis in mice

    • These findings open new research directions for VAPB in metabolic disorders and insulin resistance

  • VAPB in phospholipid metabolism and membrane dynamics:

    • VAPB recruits FFAT-motif-containing proteins to ER membranes, many of which are involved in phospholipid transfer and metabolism

    • Future research could explore how VAPB coordinates lipid exchange between organelles

    • The role of VAPB in regulating membrane composition and dynamics at organelle contact sites

    • Investigation of how altered VAPB function affects cellular lipid homeostasis and membrane fluidity

    • Development of methods to visualize and quantify VAPB-dependent lipid transfer in living cells

  • VAPB in viral infection cycles:

    • VAPB is used by hepatitis C virus (HCV) for propagation, while the naturally occurring 99 aa isoform VAP-C inhibits HCV propagation

    • This suggests research potential in understanding host-virus interactions

    • Exploration of VAPB targeting as an antiviral strategy

    • Investigation of whether other viruses similarly exploit or are inhibited by VAPB

    • Development of high-throughput screening assays for compounds that disrupt virus-VAPB interactions

  • VAPB in cellular stress responses beyond the ER:

    • Exploration of VAPB's role in integrated stress responses

    • Investigation of potential connections to oxidative stress pathways

    • Examination of VAPB function during hypoxia, nutrient deprivation, or other cellular stressors

    • Analysis of how VAPB contributes to stress granule formation and regulation

    • Development of methods to monitor VAPB-dependent stress responses in real-time

  • VAPB in microtubule organization and cellular trafficking:

    • Further characterization of VAPB's role in microtubule organization

    • Investigation of how VAPB influences vesicle trafficking and protein transport

    • Examination of VAPB's interaction with the cytoskeleton at membrane contact sites

    • Development of quantitative assays to measure VAPB-dependent effects on cellular transport

    • Analysis of how alterations in VAPB affect organelle positioning and movement

  • VAPB isoforms and their differential functions:

    • Characterization of the naturally occurring 99 aa isoform VAP-C and its regulatory effects on VAP-A and VAP-B

    • Investigation of tissue-specific expression patterns of different VAPB isoforms

    • Analysis of how alternative splicing of VAPB is regulated under different conditions

    • Development of isoform-specific detection methods and research tools

    • Exploration of whether certain isoforms have specialized functions in particular tissues or cellular processes

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.