Recombinant Bovine Vesicle-trafficking protein SEC22c (SEC22C)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference for your preparation.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
SEC22C; Vesicle-trafficking protein SEC22c; SEC22 vesicle-trafficking protein homolog C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-303
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Names
SEC22C
Target Protein Sequence
MSLILFACVVRVRDGLPLSASTDFYHSQDFLECRRRLKTLALRLAQYPGRGSAEGCDFSI HFSSSRDVACMAICSLQCPAAMAFCFLETLWWEFTASYDTTCVGLASRPYAFLEFDNVIQ KVKWHFNYVSSTQMDSSLGKIQEELKFQPPVVLTLEDTDVANGVMNGHTLMHLEPAPSFR MEPVTALGILSLILNIMCAALNLIRGIHLAEHSLQVAHEEIGNILAFLIPFVACIFQCYL YLFYSPARTMKVVLMLLFICLGNVYLHGLRNLWQILFHIGVAFLSSHQILTRQLQDKQSD CGV
Uniprot No.

Target Background

Function
Involved in vesicle trafficking between the endoplasmic reticulum (ER) and the Golgi apparatus.
Database Links
Protein Families
Synaptobrevin family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the official nomenclature for SEC22C?

The official full name is "SEC22 vesicle trafficking protein homolog C (S. cerevisiae)." It has several synonyms including SEC22L3, vesicle-trafficking protein SEC22c, MGC5373, MGC13261, and DKFZp761F2321. When documenting research, it's important to use consistent nomenclature to maintain clarity in the scientific literature .

What is the primary cellular localization of SEC22C?

SEC22C is primarily localized to the endoplasmic reticulum (ER). This localization is critical for its function in the early stages of ER-Golgi protein trafficking. When conducting immunofluorescence or subcellular fractionation studies, researchers should expect strong signals in ER fractions and potential co-localization with other ER-resident proteins .

What are the main structural domains of bovine SEC22C protein?

Bovine SEC22C contains domains typical of SNARE proteins, including a SNARE motif that facilitates interactions with other SNARE proteins during membrane fusion events. Understanding these domains is essential for designing experiments involving protein truncations or site-directed mutagenesis to assess domain-specific functions .

How does SEC22C contribute to the ER-Golgi transport pathway?

SEC22C plays a role in the early stages of protein trafficking between the endoplasmic reticulum and Golgi apparatus. It functions as part of the SNARE complex that facilitates vesicle fusion at target membranes. For experimental verification of SEC22C's role, researchers often employ dominant-negative mutants, RNA interference, or CRISPR/Cas9 gene editing to observe resulting disruptions in anterograde transport .

Which specific pathways involve SEC22C functioning?

SEC22C is involved in several critical cellular pathways including Asparagine N-linked glycosylation, COPII (Coat Protein 2) Mediated Vesicle Transport, and ER to Golgi Anterograde Transport. When designing pathway analysis experiments, researchers should consider using pathway inhibitors specific to these processes to isolate SEC22C's contribution .

How can researchers differentiate the function of SEC22C from other SEC22 family members?

To differentiate SEC22C's function from other family members (such as SEC22A), researchers should employ isoform-specific antibodies or design siRNAs targeting unique regions of SEC22C mRNA. Rescue experiments using SEC22C constructs resistant to the siRNA can confirm specificity. Additionally, comparative analysis of protein-protein interaction profiles can highlight functional differences between family members .

What are the key biochemical functions of SEC22C protein?

SEC22C demonstrates several biochemical functions including SNAP receptor activity, SNARE binding, and protein binding. These functions enable SEC22C to participate in membrane fusion events during vesicle trafficking. When designing biochemical assays, researchers should include appropriate controls to distinguish SEC22C-specific activities from those of related SNARE proteins .

Which proteins have been identified as interaction partners of SEC22C?

SEC22C has been shown to interact with FATE1 and likely interacts with other SNARE proteins. The interactions with SNARE proteins are functionally significant for vesicle fusion events. Methods such as co-immunoprecipitation, yeast two-hybrid assays, and proximity ligation assays are appropriate for validating these interactions in different cellular contexts .

How does the SNARE binding capability of SEC22C compare to other related proteins?

The SNARE binding function of SEC22C shares similarities with other proteins including SEC22A, VAMP7, VAMP3, VAMP2, VAMP1, VTI1A, STX7, and TNFAIP2. When comparing binding affinities or specificities, researchers should employ quantitative binding assays such as surface plasmon resonance or isothermal titration calorimetry with purified components .

What are the optimal methods for isolating active recombinant bovine SEC22C protein?

For isolating active recombinant bovine SEC22C, expression in mammalian cell systems (particularly HEK293 cells) often yields properly folded and functionally active protein. Critical steps include: (1) Designing constructs with appropriate tags (His, Fc, or Avi tags) for purification; (2) Optimizing expression conditions to prevent aggregation; (3) Employing gentle purification procedures to maintain native conformation; and (4) Validating protein activity through functional assays that assess SNARE complex formation .

How can researchers effectively detect SEC22C in bovine tissue samples?

For detecting SEC22C in bovine tissue samples, researchers should consider a multi-method approach:

  • Western blotting using validated antibodies specific to bovine SEC22C

  • Immunohistochemistry with appropriate fixation protocols for membrane proteins

  • RT-qPCR for mRNA expression analysis with carefully designed primers spanning exon-exon junctions

  • Mass spectrometry for unbiased protein identification and quantification

Validation across multiple detection methods strengthens confidence in experimental findings .

What considerations are important when designing knockout or knockdown studies for SEC22C?

When designing knockout or knockdown studies for SEC22C, researchers should:

  • Consider potential compensatory mechanisms from other SEC22 family members

  • Evaluate the efficiency of knockdown using both mRNA and protein measurements

  • Include rescue experiments with wild-type SEC22C to confirm phenotype specificity

  • Monitor for off-target effects, particularly on other vesicle trafficking proteins

  • Assess both acute and chronic depletion effects, as they may differ significantly due to cellular adaptation

How can metabolomic approaches be integrated with SEC22C functional studies in bovine systems?

Integrating metabolomics with SEC22C functional studies can reveal downstream effects of trafficking disruptions. Methodology should include:

  • Establishing SEC22C knockdown or knockout bovine cell lines

  • Performing untargeted metabolomic profiling using CE-TOFMS (capillary electrophoresis time-of-flight mass spectrometry)

  • Conducting principal component analysis (PCA) and partial least squares (PLS) analysis to identify metabolite patterns associated with SEC22C alterations

  • Validating key metabolite changes through targeted assays

  • Correlating metabolic changes with specific trafficking defects through complementary cellular assays

This integrated approach can reveal how SEC22C-mediated trafficking influences cellular metabolism .

What methodological approaches are recommended for studying SEC22C's role in ER stress responses?

To investigate SEC22C's role in ER stress responses, researchers should employ:

  • Induction of ER stress using pharmacological agents (tunicamycin, thapsigargin, DTT) in systems with normal and altered SEC22C expression

  • Time-course analysis of canonical ER stress markers (BiP, CHOP, XBP1 splicing)

  • Subcellular localization studies to track SEC22C redistribution during stress

  • Proteomic analysis of SEC22C interaction partners under normal versus stress conditions

  • Live-cell imaging with fluorescently tagged SEC22C to monitor dynamic responses

Data analysis should incorporate both qualitative assessment of localization changes and quantitative measurements of stress response markers .

How should researchers approach studying species-specific differences in SEC22C function?

When investigating species-specific differences in SEC22C function, a systematic comparative approach is recommended:

ApproachMethodologyData Analysis
Sequence comparisonMultiple sequence alignment of SEC22C from different speciesIdentification of conserved domains and species-specific variations
Expression profilingRT-qPCR and Western blot analysis of SEC22C across tissues from different speciesQuantitative comparison of expression patterns
Functional assaysComplementation studies in knockout systems with SEC22C from different speciesStatistical analysis of rescue efficiency
Interaction mappingImmunoprecipitation followed by mass spectrometryNetwork analysis to identify species-specific interaction partners
Localization studiesImmunofluorescence with species-specific antibodiesQuantitative co-localization analysis

This multi-faceted approach enables identification of both conserved and divergent aspects of SEC22C function across species .

What strategies can address the challenge of SEC22C antibody cross-reactivity with other SEC22 family members?

To overcome antibody cross-reactivity issues:

  • Utilize epitope mapping to identify unique regions of SEC22C for antibody generation

  • Perform extensive validation using positive controls (overexpressed SEC22C) and negative controls (SEC22C knockout samples)

  • Consider using tagged versions of SEC22C in experimental systems where possible

  • Employ multiple antibodies targeting different epitopes and compare results

  • Supplement antibody-based detection with nucleic acid-based methods for isoform-specific detection

Rigorous antibody validation is essential for confident interpretation of experimental results .

How can researchers differentiate between direct and indirect effects when studying SEC22C function?

To distinguish direct from indirect effects in SEC22C studies:

  • Employ acute inactivation strategies (e.g., auxin-inducible degron systems) to observe immediate consequences before compensatory mechanisms occur

  • Design rescue experiments with wild-type and mutant versions of SEC22C

  • Utilize proximity labeling approaches (BioID, APEX) to identify the immediate molecular neighborhood of SEC22C

  • Perform time-course experiments to distinguish primary from secondary effects

  • Develop in vitro reconstitution assays with purified components to confirm direct biochemical activities

This multi-pronged approach helps establish causality in complex cellular systems .

What are the best approaches for quantifying SEC22C-mediated vesicle trafficking events?

For quantifying SEC22C-mediated trafficking events, researchers should consider:

  • Employing cargo transport assays with synchronized release of fluorescently-labeled cargo proteins

  • Utilizing live-cell imaging with vesicle tracking algorithms to measure transport kinetics

  • Developing FRET-based sensors to detect SEC22C engagement in SNARE complexes

  • Applying super-resolution microscopy techniques to resolve individual trafficking vesicles

  • Implementing quantitative electron microscopy to assess morphological changes in trafficking organelles

Statistical analysis should include measurements of both rate and efficiency of transport processes, with appropriate controls for non-specific effects .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.