Recombinant Bovine Vesicle transport protein GOT1B (GOLT1B)

Shipped with Ice Packs
In Stock

Description

Functional Role in COPII Vesicle Formation

GOT1B facilitates COPII prebudding complex assembly by interacting with Sec23/Sec24 heterodimers and Sar1 GTPase. Key functional insights from homologs:

  • Interaction Partners:

    SpeciesInteracting ProteinsMethodReference
    RiceSec23a/b/c, Sar1bY2H, BiFC, co-IP
    HumanSec23 (predicted)Phylogenetic conservation
    BovineSec23/Sar1 (inferred)Homology modeling
  • Mechanism:

    • Stabilizes Sar1-Sec23 complexes at ERESs, enhancing COPII coat assembly .

    • Loss of GOT1B disrupts ERES organization and cargo (e.g., proglutelin) export in rice .

Recombinant Expression Systems

While no bovine-specific expression data exists, recombinant GOT1B homologs are typically produced using:

Expression SystemAdvantagesChallenges
E. coliHigh yield, low costLack of post-translational modifications
Yeast (Pichia)Eukaryotic processingLower throughput
Plant transient systems (e.g., N. benthamiana)Functional in vivo localization studiesTime-intensive optimization

Key Studies on Homologs

  • Rice GOT1B:

    • Mutants (gpa4) accumulate 57-kD glutelin precursors in ER-derived structures, confirming its role in COPII vesicle formation .

    • Colocalizes with Sar1b at ERESs and physically interacts with Sec23 isoforms .

  • Human GOT1B:

    • Linked to ER-Golgi trafficking defects; structural predictions highlight conserved transmembrane domains .

Implications for Bovine Studies

  • Biotechnology: Enhancing recombinant protein secretion in livestock-derived cell lines.

  • Disease Models: Studying GOT1B dysregulation in congenital disorders of glycosylation.

Unresolved Questions and Future Directions

  • Does bovine GOT1B regulate RNA localization for cargo sorting, as seen in rice ?

  • How do species-specific isoforms modulate COPII kinetics?

  • Can bovine GOT1B rescue trafficking defects in plant or yeast mutants?

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please specify it in your order notes. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery times, please consult your local distributors.
Note: Our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquotting the solution at -20°C/-80°C. Our default final glycerol concentration is 50%. You can use this as a reference.
Shelf Life
The shelf life is influenced by several factors including storage conditions, buffer ingredients, storage temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type preference, please inform us and we will prioritize developing the specified tag.
Synonyms
GOLT1B; Vesicle transport protein GOT1B; Golgi transport 1 homolog B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-138
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Names
GOLT1B
Target Protein Sequence
MISLTDTQKIGMGLTGFGVFFLFFGMILFFDKALLAIGNVLFVAGLAFVIGLERTFRFFF QKHKMKATGFFLGGVFVVLIGWPLIGMIFEIYGFFLLFRGFFPVVVGFIRRVPVLGSLLN LPGIRSFVDKVGESNNMV
Uniprot No.

Target Background

Function
This protein may play a role in the fusion of ER-derived transport vesicles with the Golgi complex.
Database Links
Protein Families
GOT1 family
Subcellular Location
Golgi apparatus membrane; Multi-pass membrane protein.

Q&A

What is the fundamental function of bovine GOLT1B protein?

Bovine GOLT1B functions as a golgi vesicle transporter protein essential for post-Golgi trafficking pathways. It facilitates the movement of cargo proteins between membrane compartments within the secretory pathway. Similar to its homologs in other species, bovine GOLT1B likely participates in vesicle formation, tethering, and fusion processes that are critical for proper protein sorting and delivery to target destinations . In rice, GOLT1B (also known as GPA4/GLUP2) has been directly implicated in vesicle-mediated glutelin transport . The highly conserved nature of vesicular trafficking mechanisms suggests bovine GOLT1B serves analogous functions in mammalian systems, specifically in the transport of secretory proteins through the Golgi apparatus to their final destinations.

What expression systems are most efficient for producing recombinant bovine GOLT1B?

For expressing recombinant bovine GOLT1B, researchers typically employ either prokaryotic (E. coli) or eukaryotic expression systems (insect cells, mammalian cells, or yeast). Based on research with similar membrane proteins, mammalian expression systems (particularly HEK293 or CHO cells) often yield properly folded and functional GOLT1B with native post-translational modifications. For experimental applications requiring higher protein yields, baculovirus-infected insect cells (Sf9 or Hi5) represent a viable alternative. When using prokaryotic systems, fusion tags (such as MBP or SUMO) can enhance solubility, though membrane proteins like GOLT1B frequently require detergent solubilization and refolding protocols. Expression vectors incorporating affinity tags (His6, FLAG, or GST) facilitate subsequent purification while epitope tags enable detection in downstream applications.

What is the typical cellular localization pattern of GOLT1B?

GOLT1B predominantly localizes to the Golgi apparatus membrane, specifically in the vesicular transport system between Golgi compartments. Immunofluorescence microscopy typically reveals a perinuclear, punctate staining pattern characteristic of Golgi proteins. Co-localization studies with known Golgi markers (such as GM130 for cis-Golgi or TGN46 for trans-Golgi network) help determine its precise sub-compartmental distribution. During cell fractionation experiments, GOLT1B partitions with membrane fractions and can be further isolated in Golgi-enriched fractions through differential centrifugation. In some contexts, a portion of GOLT1B may also be detected in transport vesicles as they move between compartments, reflecting its dynamic role in vesicular trafficking.

What protein-protein interactions are critical for bovine GOLT1B function?

Based on research with homologous systems, bovine GOLT1B likely participates in several key protein-protein interactions essential for its vesicular transport functions. Studies in other systems suggest GOLT1B may interact with:

  • Rab GTPases: Particularly members of the Rab5 and Rab7 families that regulate vesicle formation, movement, and fusion

  • SNARE proteins: Mediating membrane fusion events during vesicle transport

  • Coat proteins: Including components of COPI or COPII complexes involved in vesicle budding

Research indicates that in rice, GOT1B is involved in vesicle-mediated glutelin transport pathways that include interactions with other trafficking components . To identify specific interaction partners of bovine GOLT1B, researchers typically employ techniques such as co-immunoprecipitation, yeast two-hybrid screening, or proximity labeling approaches (BioID or APEX). Understanding these interactions provides crucial insights into GOLT1B's precise role within the vesicular transport machinery.

How does phosphorylation regulate bovine GOLT1B activity and function?

Phosphorylation likely serves as a key regulatory mechanism for bovine GOLT1B activity. While specific data on bovine GOLT1B phosphorylation is limited, research on related trafficking proteins indicates that phosphorylation can modulate protein-protein interactions, subcellular localization, and trafficking activity. Studies on human GOLT1B regulation suggest that altered phosphorylation of transcription factors like JUN and SIN3A affects GOLT1B expression .

To investigate bovine GOLT1B phosphorylation:

  • Utilize phospho-specific antibodies to detect endogenous phosphorylation states

  • Employ mass spectrometry-based phosphoproteomics to identify specific phosphorylation sites

  • Create phosphomimetic (S/T to D/E) and phospho-deficient (S/T to A) mutants to evaluate functional consequences

  • Use kinase inhibitors to identify the responsible kinases regulating GOLT1B

Researchers should consider that phosphorylation may occur in response to specific cellular conditions, such as stress, nutrient availability, or cell cycle progression, potentially enabling dynamic regulation of vesicular trafficking pathways.

How do mutations in bovine GOLT1B affect protein trafficking pathways?

Mutations in bovine GOLT1B likely disrupt normal vesicular trafficking pathways, potentially affecting the transport of cargo proteins to their intended destinations. Based on studies in other systems, key mutations might affect:

  • Transmembrane domains: Disrupting proper Golgi localization

  • Cytoplasmic domains: Impairing interactions with trafficking machinery or regulatory proteins

  • Post-translational modification sites: Preventing proper regulation of activity

Research approaches to investigate mutation effects include:

  • Creating targeted mutations using CRISPR/Cas9 genome editing in bovine cell lines

  • Expressing mutant GOLT1B constructs and assessing trafficking of model cargo proteins

  • Conducting live-cell imaging studies to visualize trafficking dynamics

  • Performing biochemical assays to measure vesicle formation, fusion, and transport rates

In rice, mutations in GOLT1B homologs disrupted the trafficking of storage proteins, leading to their mislocalization . Similar phenotypes might be expected in bovine systems, potentially affecting the secretion or localization of important bovine proteins.

How does the interaction between GOLT1B and SNARE proteins facilitate membrane fusion events?

The interaction between bovine GOLT1B and SNARE proteins likely plays a crucial role in facilitating membrane fusion events during vesicular trafficking. SNARE proteins form the core machinery for membrane fusion, and GOLT1B may function to regulate their assembly, localization, or activity.

Potential mechanisms include:

  • Direct binding to SNARE proteins to regulate complex assembly

  • Facilitating the recruitment of SNARE proteins to specific membrane domains

  • Modulating SNARE protein conformation to promote fusion competence

  • Coordinating the activities of SNARE proteins with other trafficking regulators

Research approaches to investigate these interactions include:

  • Yeast two-hybrid or split-ubiquitin assays to detect direct interactions

  • FRET or BRET analysis to monitor protein-protein interactions in live cells

  • Reconstitution assays using purified components to assess effects on SNARE-mediated fusion

  • Structure-function studies to identify interaction domains

Understanding these interactions would provide mechanistic insights into how GOLT1B contributes to the specificity and efficiency of membrane fusion events in the secretory pathway.

What are the optimal conditions for purifying recombinant bovine GOLT1B?

Purification of recombinant bovine GOLT1B requires specialized approaches due to its nature as a membrane protein. The following methodology represents an optimized protocol:

  • Expression System Selection:

    • Mammalian cells (HEK293) for native folding and modifications

    • Insect cells (Sf9) for higher yields

    • Avoid prokaryotic systems unless using fusion partners (MBP, SUMO)

  • Solubilization Strategy:

    • Utilize mild detergents (DDM, LMNG, or digitonin) at concentrations just above CMC

    • Include stabilizers like cholesterol hemisuccinate or glycerol (10-15%)

    • Maintain physiological pH (7.2-7.5) and ionic strength

  • Purification Steps:

    • Initial affinity chromatography using His-tag or FLAG-tag

    • Size exclusion chromatography to remove aggregates

    • Optional ion exchange chromatography for higher purity

  • Quality Control:

    • Western blotting to confirm identity

    • Size exclusion chromatography coupled with multi-angle light scattering (SEC-MALS) to assess homogeneity

    • Negative stain electron microscopy to evaluate structural integrity

For functional studies, consider reconstitution into nanodiscs or proteoliposomes to maintain native-like membrane environment and activity.

How can researchers effectively detect and quantify GOLT1B expression levels?

Researchers can employ multiple complementary techniques to detect and quantify bovine GOLT1B expression:

  • Transcriptional Analysis:

    • RT-qPCR using validated primer pairs spanning exon junctions

    • RNA-seq for genome-wide expression profiling

    • Northern blotting for transcript size verification

  • Protein Detection:

    • Western blotting using specific antibodies against bovine GOLT1B

    • Immunofluorescence microscopy for localization studies

    • Flow cytometry for population-level quantification

  • Quantitative Assessment:

    • ELISA for absolute quantification

    • Mass spectrometry (SRM/MRM) for precise quantification

    • Fluorescent fusion proteins for live-cell monitoring

For monitoring dynamic changes in GOLT1B expression, consider using reporter constructs containing the GOLT1B promoter driving fluorescent protein expression. When analyzing expression in different contexts, normalization to appropriate reference genes or proteins is essential for accurate comparisons.

What methodologies are most effective for studying GOLT1B trafficking dynamics?

To study the dynamic trafficking behavior of bovine GOLT1B, researchers should employ a combination of advanced imaging and biochemical approaches:

  • Live-Cell Imaging Techniques:

    • FRAP (Fluorescence Recovery After Photobleaching) to measure protein mobility

    • Photoactivation/photoconversion to track protein movement between compartments

    • Dual-color imaging with compartment markers to monitor localization changes

  • Super-Resolution Microscopy:

    • STED or STORM microscopy to resolve sub-Golgi localization

    • 3D-SIM for visualizing spatial relationships with trafficking components

  • Biochemical Approaches:

    • Subcellular fractionation coupled with Western blotting

    • Density gradient centrifugation to isolate transport vesicles

    • Cell-free reconstitution assays to monitor transport steps

  • Cargo Tracking:

    • Pulse-chase analysis of model cargo proteins

    • Retention using selective hooks (RUSH) system to synchronize cargo release

    • Correlative light-electron microscopy to connect dynamics with ultrastructure

These methodologies can be combined with molecular perturbations (mutations, inhibitors, etc.) to dissect the specific role of GOLT1B in trafficking pathways.

What strategies help overcome challenges in generating GOLT1B knockout or knockdown models?

Creating effective GOLT1B knockout or knockdown models presents several challenges due to potential essential functions or compensatory mechanisms. Researchers should consider these strategies:

  • For Transient Knockdown:

    • siRNA pools targeting multiple regions of GOLT1B mRNA

    • Validated shRNA constructs with inducible expression systems

    • Antisense oligonucleotides for in vivo applications

  • For Stable Knockout:

    • CRISPR/Cas9 with multiple guide RNAs targeting early exons

    • Conditional knockout strategies using Cre-loxP or similar systems

    • Auxin-inducible degron (AID) system for protein-level depletion

  • Addressing Lethality Concerns:

    • Inducible systems to control the timing of knockout/knockdown

    • Tissue-specific or cell-type-specific targeting

    • Partial knockdown approaches to maintain minimal function

  • Validation Approaches:

    • Confirming knockout/knockdown at both mRNA and protein levels

    • Phenotypic rescue experiments with wild-type GOLT1B

    • Assessment of potential compensatory changes in related genes

When designing targeting strategies, consider potential off-target effects and include appropriate controls (scrambled siRNAs, non-targeting gRNAs) in all experiments.

How can researchers troubleshoot non-specific binding issues in GOLT1B interaction studies?

Non-specific binding represents a common challenge in GOLT1B interaction studies, particularly due to its membrane protein nature. Researchers can implement these troubleshooting strategies:

  • Optimizing Co-Immunoprecipitation Conditions:

    • Test multiple detergent types and concentrations

    • Include blocking agents (BSA, non-fat milk) in washing buffers

    • Increase salt concentration incrementally (150-500 mM)

    • Use two-step purification approaches with different tags

  • Confirming Specificity:

    • Include negative controls (IgG, unrelated membrane proteins)

    • Perform reciprocal pull-downs with suspected interaction partners

    • Use competition assays with unlabeled proteins

    • Generate interaction-deficient mutants based on structural predictions

  • Alternative Approaches:

    • Proximity labeling methods (BioID, APEX) for in-cell validation

    • Yeast two-hybrid with split-ubiquitin systems for membrane proteins

    • Surface plasmon resonance or microscale thermophoresis for direct binding kinetics

    • Cross-linking mass spectrometry to capture transient interactions

  • Data Validation:

    • Perform biological replicates with different antibody lots

    • Compare results across multiple interaction detection methods

    • Apply stringent statistical analysis to differentiate true from false positives

When interpreting interaction results, consider the biological context and functional relevance of potential interactions to prioritize follow-up studies.

How can recombinant bovine GOLT1B be used to study vesicular trafficking disorders?

Recombinant bovine GOLT1B serves as a valuable tool for investigating vesicular trafficking disorders that may impact bovine health or provide models for human diseases. Researchers can utilize recombinant GOLT1B in several approaches:

  • In vitro Reconstitution Systems:

    • Establish cell-free assays with purified components to recapitulate specific trafficking steps

    • Incorporate disease-associated mutations to assess functional impacts

    • Screen for small molecules that modulate GOLT1B activity

  • Cellular Models:

    • Rescue experiments in GOLT1B-depleted cells to assess functional complementation

    • Create reporter systems to monitor trafficking efficiency and fidelity

    • Develop high-content screening platforms for identifying trafficking modulators

  • Structural Biology Applications:

    • Generate antibodies or nanobodies against GOLT1B as research tools

    • Use purified protein for structural determination by cryo-EM or X-ray crystallography

    • Design structure-based therapeutic approaches targeting GOLT1B or its interactors

These applications can provide insights into both fundamental mechanisms of vesicular trafficking and potential therapeutic approaches for disorders involving secretory pathway dysfunction .

What emerging technologies are advancing our understanding of GOLT1B function?

Several cutting-edge technologies are revolutionizing research on proteins like bovine GOLT1B:

  • Advanced Imaging Technologies:

    • Lattice light-sheet microscopy for long-term, high-resolution imaging of trafficking dynamics

    • Expansion microscopy for improved spatial resolution of Golgi subcompartments

    • Cryo-electron tomography for visualizing native membrane environments

  • Proteomics and Interactomics:

    • Proximity-dependent biotinylation (BioID, TurboID) for mapping spatial proteomes

    • Crosslinking mass spectrometry for capturing transient interactions

    • Thermal proteome profiling to assess protein stability and interactions

  • Genome Engineering:

    • Base editing and prime editing for precise genetic modifications

    • CRISPR interference/activation for reversible transcriptional regulation

    • CRISPR screens to identify functional partners and pathways

  • Computational Approaches:

    • AlphaFold2 and RoseTTAFold for protein structure prediction

    • Molecular dynamics simulations of membrane protein behavior

    • Machine learning for predicting protein-protein interactions

These technologies enable researchers to address previously intractable questions about GOLT1B's structure, dynamics, interactions, and functions at unprecedented resolution and scale.

How does bovine GOLT1B function compare with its homologs in other species?

Comparative analysis of GOLT1B across species reveals both conserved and divergent features:

SpeciesSequence Identity to Bovine GOLT1BKey Functional DomainsNotable Species-Specific Features
Human~90-95% (estimated)Transmembrane domainsAssociated with breast cancer progression
Mouse~85-90% (estimated)Transmembrane domainsSimilar developmental expression patterns
Rice~30-40% (estimated)Transmembrane domainsInvolved in storage protein trafficking
Yeast~25-35% (estimated)Transmembrane domainsFunctions in ER-Golgi transport
  • Tissue expression patterns vary between species

  • Regulatory mechanisms show species-specific adaptations

  • Interaction partners may differ, reflecting evolutionary divergence

  • Cellular roles may be expanded or specialized in certain lineages

For example, in rice, GOLT1B (GPA4/GLUP2) is directly involved in vesicle-mediated glutelin transport , while in humans, GOLT1B has been implicated in cancer progression and immune modulation . These differences highlight the evolutionary adaptation of core trafficking machinery to species-specific physiological requirements.

What are the current limitations in GOLT1B research and how might they be addressed?

Current GOLT1B research faces several significant limitations:

  • Structural Challenges:

    • Limited structural data on full-length GOLT1B

    • Difficulty crystallizing membrane proteins

    • Solution: Apply cryo-EM, NMR approaches, or membrane mimetics

  • Functional Ambiguity:

    • Incomplete understanding of precise molecular mechanism

    • Potential redundancy with related proteins

    • Solution: Develop acute depletion systems and specific inhibitors

  • Technical Barriers:

    • Challenges in real-time tracking of endogenous protein

    • Limited availability of species-specific research tools

    • Solution: Generate knock-in fluorescent tags and develop bovine-specific antibodies

  • Translational Gaps:

    • Unclear relevance to bovine health and disease

    • Limited in vivo studies in relevant animal models

    • Solution: Establish collaborations with veterinary researchers and develop tissue-specific conditional models

  • Research Focus:

    • Concentration on model organisms rather than bovine systems

    • Limited integration of multi-omics data

    • Solution: Dedicate resources to bovine-specific studies and multi-dimensional data integration

Addressing these limitations will require interdisciplinary approaches combining structural biology, cell biology, genetics, and systems biology perspectives.

How might GOLT1B research inform our understanding of cellular adaptation to stress?

GOLT1B likely plays important roles in cellular adaptation to various stress conditions through its function in vesicular trafficking:

  • ER Stress Response:

    • GOLT1B may facilitate increased secretory pathway capacity during ER stress

    • Potential regulation of unfolded protein response (UPR) signaling

    • Research approach: Monitor GOLT1B expression and localization during chemical ER stress induction

  • Nutrient Deprivation:

    • Possible role in autophagy-related membrane trafficking

    • Adaptation of secretory pathway during resource limitation

    • Research approach: Assess GOLT1B function in cells undergoing starvation-induced autophagy

  • Oxidative Stress:

    • Protection of cargo proteins from oxidative damage during transport

    • Maintenance of Golgi integrity under oxidative conditions

    • Research approach: Examine redox-dependent modifications of GOLT1B and functional consequences

  • Immune Challenge:

    • Regulation of immune receptor trafficking during infection

    • Facilitation of cytokine secretion in immune cells

    • Research approach: Study GOLT1B dynamics in bovine immune cells during pathogen challenge

Understanding these stress-adaptive functions could provide insights into cellular resilience mechanisms and potential therapeutic targets for conditions involving secretory pathway dysfunction or stress adaptation failure.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.