Recombinant Bovine Vitamin K epoxide reductase complex subunit 1 (VKORC1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a particular tag, please specify it in your order for preferential development.
Synonyms
VKORC1; Vitamin K epoxide reductase complex subunit 1; Vitamin K1 2,3-epoxide reductase subunit 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-163
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Names
VKORC1
Target Protein Sequence
MGATWRSPGWVRLALCLAGLVLSLYALHVKAARARDRDYRALCDVGTAISCSRVFSSRWG RGFGLVEHVLGKDSILNQSNSIFGCIFYTLQLLLGCLQGRWASVLLRLSCLVSLAGSVYL AWILFFVLYDFCIVCITTYAINVGLTVLSFREVQGPQGKVKGH
Uniprot No.

Target Background

Function

Vitamin K epoxide reductase complex subunit 1 (VKORC1) is involved in vitamin K metabolism. It serves as the catalytic subunit of the VKOR complex, reducing inactive vitamin K 2,3-epoxide to its active form. Vitamin K is essential for the γ-carboxylation of various proteins, including coagulation factors, and is crucial for normal blood coagulation and bone development.

Database Links

KEGG: bta:445422

STRING: 9913.ENSBTAP00000000519

UniGene: Bt.1707

Protein Families
VKOR family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the biological role of bovine VKORC1?

Bovine VKORC1 functions as the catalytic subunit of the vitamin K epoxide reductase (VKOR) complex, which plays a critical role in vitamin K metabolism. The enzyme catalyzes the reduction of inactive vitamin K 2,3-epoxide to active vitamin K, a critical step in the vitamin K cycle. This recycling process is essential for the gamma-carboxylation of various proteins, including blood coagulation factors, which require this post-translational modification for normal function. Beyond hemostasis, VKORC1 activity is necessary for proper bone development through its support of vitamin K-dependent processes .

Unlike simple redox enzymes, VKORC1 operates within a complex system that interfaces with multiple biochemical pathways, making it an intriguing target for both basic science investigation and therapeutic development. The bovine variant shares high homology with human VKORC1 while offering certain experimental advantages in expression and stability studies.

How does bovine VKORC1 compare structurally to human VKORC1?

Bovine VKORC1 shares significant structural homology with human VKORC1, which consists of 163 amino acids arranged in an integral endoplasmic reticulum (ER) membrane protein with multiple transmembrane alpha-helices. Both proteins contain highly conserved cysteine residues that are critical for their redox function, particularly within a characteristic tetrapeptide motif. These conserved sites are preserved across species, underscoring their essential role in the protein's catalytic mechanism .

The core structure includes multiple transmembrane domains that anchor the protein in the ER membrane, with specific regions responsible for vitamin K binding and enzymatic reduction. While the human ortholog contains three to four predicted transmembrane domains, research indicates differences in membrane topology between VKORC1 and its paralog VKORC1L1, which possesses four transmembrane domains with both termini located in the cytoplasm . Structural studies of bovine VKORC1 have contributed significantly to understanding these evolutionary relationships and structural determinants of function.

What expression systems are most effective for producing recombinant bovine VKORC1?

Multiple expression systems have proven effective for recombinant VKORC1 production, each with distinct advantages depending on research objectives. Insect cell systems using Spodoptera frugiperda (Sf9) cells have demonstrated enhanced VKOR activity over endogenous levels, making them suitable for structural studies and activity assays. Similarly, the yeast Pichia pastoris has been successfully employed for VKORC1 expression, offering advantages for scaled protein production with eukaryotic post-translational processing .

For mammalian expression, Chinese Hamster Ovary (CHO) cells represent a gold standard system, particularly when investigating interactions with other components of the vitamin K cycle or producing functional vitamin K-dependent proteins. CHO cells provide the cellular machinery necessary for proper folding, membrane insertion, and functional testing of recombinant bovine VKORC1 . The choice of expression system should align with specific experimental goals, whether focused on structural characterization, functional analysis, or co-expression studies with vitamin K-dependent proteins.

How can researchers optimize purification of recombinant bovine VKORC1?

Purification of recombinant bovine VKORC1 presents challenges typical of membrane proteins. Effective strategies typically employ affinity tags such as polyhistidine (His-tag) for initial capture, as demonstrated with full-length rat VKORC1 constructs . The purification workflow must carefully balance detergent selection with preservation of protein structure and activity.

An optimized protocol involves:

  • Expression in an appropriate system (e.g., E. coli, insect cells, or yeast)

  • Membrane fraction isolation through differential centrifugation

  • Solubilization using mild detergents compatible with membrane proteins

  • Affinity chromatography utilizing His-tag or other fusion partners

  • Size exclusion chromatography for final polishing and removal of aggregates

Critical considerations include maintaining reducing conditions throughout purification to preserve catalytic cysteine residues and careful buffer optimization to retain native-like membrane protein folding. For functional studies, reconstitution into liposomes or nanodiscs may be necessary to provide a lipid environment approximating the endoplasmic reticulum.

What methods are most reliable for measuring bovine VKORC1 enzymatic activity?

Assessment of recombinant bovine VKORC1 activity requires methodologies that can accurately quantify vitamin K epoxide reduction. The most reliable approaches include:

  • Vitamin K epoxide reduction assay: This direct method measures the conversion of vitamin K epoxide to vitamin K using HPLC or LC-MS/MS detection systems. This approach provides the most direct assessment of VKORC1's primary catalytic function but requires specialized analytical equipment.

  • Coupled functional assays: Researchers can measure VKORC1 activity indirectly by coupling it to vitamin K-dependent carboxylation. For example, co-expression of VKORC1 with a vitamin K-dependent protein like Factor IX or Factor VII allows activity assessment through:

    • ELISA quantification of the carboxylated protein

    • Functional clotting assays measuring specific activity of the carboxylated product

In experimental systems, VKORC1 activity demonstrates characteristic responses to vitamin K concentration. As shown in transient transfection experiments, VKORC1 co-expression significantly increases both the productivity and specific activity of vitamin K-dependent proteins, with improvements of up to four-fold observed at various vitamin K concentrations . These functional outcomes provide robust metrics for VKORC1 activity assessment.

How do mutations in conserved cysteine residues impact VKORC1 function?

Conserved cysteine residues play critical roles in VKORC1's catalytic mechanism, with specific functions that differ between VKORC1 and its paralog VKORC1L1. In VKORC1L1, four conserved cysteines function in concert for active site regeneration through an intramolecular electron transfer pathway. This contrasts with VKORC1, where loop cysteines are not essential for activity .

Mutation studies reveal that:

  • The active site cysteines form a crucial disulfide bond that participates directly in the reduction of vitamin K epoxide

  • Loop cysteines in VKORC1L1 demonstrate a coordinated mechanism where Cys-58 attacks the active site disulfide, forming an intermediate disulfide with Cys-139

  • Subsequently, Cys-50 attacks this intermediate disulfide, completing the electron transfer pathway

These structure-function relationships provide insights into potential differences in physiological functions between VKORC1 and VKORC1L1, with implications for drug development and understanding vitamin K metabolism. Mutations affecting these conserved cysteines directly impact catalytic efficiency and can alter sensitivity to anticoagulant drugs.

How does co-expression of bovine VKORC1 enhance production of vitamin K-dependent proteins?

Co-expression of recombinant bovine VKORC1 with vitamin K-dependent (VKD) proteins represents a powerful strategy for enhancing the production of fully carboxylated, functional VKD proteins. Experimental evidence demonstrates that VKORC1 co-expression improves both productivity and functional activity of recombinant Factor VII (rFVII) and Factor IX (rFIX) .

The mechanism behind this enhancement involves:

  • Increased recycling of vitamin K, supporting the γ-carboxylation reaction

  • More efficient utilization of vitamin K added to the cell culture medium

  • Enhanced production of correctly carboxylated VKD proteins with proper function

What experimental design considerations are important when studying VKORC1-VKD protein interactions?

When investigating interactions between bovine VKORC1 and vitamin K-dependent proteins, several critical experimental design considerations emerge:

  • Vitamin K depletion and supplementation strategy: Initial depletion of cellular vitamin K reserves (through serum-free culture) followed by controlled supplementation at various concentrations (0-5 μg/mL) enables precise assessment of VKORC1's impact on VKD protein production .

  • Selection of appropriate VKD protein readouts: Both quantitative (ELISA) and functional (clotting activity) measurements should be employed to comprehensively evaluate the impact of VKORC1 on VKD protein production and activity.

  • Time-course considerations: Collection of supernatants at appropriate time points (typically 24 hours post-treatment) ensures optimal detection of VKORC1-mediated effects .

  • Control systems: Parallel transfections with empty vectors without VKORC1-encoding cDNA provide essential controls for isolating VKORC1-specific effects .

Additionally, researchers should consider the potential for cellular quality control mechanisms that retain incompletely γ-carboxylated VKD proteins intracellularly, which may influence interpretation of secreted protein measurements .

How does bovine VKORC1 compare to VKORC1L1, and what are the functional implications?

Bovine VKORC1 and VKORC1L1 represent paralogous enzymes sharing approximately 50% protein identity, yet they exhibit significant structural and functional differences. While both can reduce vitamin K epoxide to support vitamin K-dependent carboxylation, their mechanisms and likely physiological roles differ substantially .

Key comparative features include:

  • Membrane topology: VKORC1L1 possesses four transmembrane domains with both termini located in the cytoplasm, contrasting with VKORC1's structure .

  • Active site regeneration: VKORC1L1 uniquely employs conserved loop cysteines for active site regeneration through an intramolecular electron transfer pathway, while these cysteines are not required for VKORC1 activity .

  • Disulfide formation patterns: VKORC1L1 demonstrates a concerted action of four conserved cysteines, with Cys-58 attacking the active site disulfide to form an intermediate disulfide with Cys-139, followed by Cys-50 attacking this intermediate .

These structural and mechanistic differences strongly suggest distinct physiological functions between these paralogs, with implications for their respective roles in vitamin K metabolism, cellular redox regulation, and response to anticoagulant drugs. The evolutionary conservation of both proteins across species underscores their biological importance beyond simply redundant functions.

What evolutionary insights can be gained from studying VKORC1 across species?

VKORC1 belongs to a large family of homologous genes widely distributed across evolutionary taxa, including vertebrates, insects, plants, protists, archaea, and bacteria. This broad conservation suggests ancient origins and potentially diverse functions beyond vitamin K metabolism .

Across these diverse orthologs, five amino acids remain completely conserved, including two cysteines within a tetrapeptide motif critical for redox function. This extraordinary conservation highlights essential structural elements required for the core catalytic mechanism, while species-specific variations may reflect adaptation to different physiological demands or environmental conditions .

Comparative analysis of VKORC1 across species provides insights into:

  • The evolution of the vitamin K cycle and vitamin K-dependent carboxylation

  • Structural determinants of enzyme function and regulatory mechanisms

  • Species-specific variations that may inform drug development, particularly regarding anticoagulant sensitivity and resistance

These evolutionary perspectives not only enhance our understanding of VKORC1 biology but also provide valuable context for interpreting experimental results and translating findings across species.

How can recombinant bovine VKORC1 contribute to anticoagulant drug development?

Recombinant bovine VKORC1 serves as a valuable tool for investigating anticoagulant mechanisms and developing novel therapeutic approaches. As the target of coumarin-derived drugs widely used in thrombosis therapy and prophylaxis, VKORC1 structure-function studies provide essential insights for rational drug design .

Research applications include:

  • Drug screening platforms: Recombinant bovine VKORC1 can be incorporated into high-throughput screening systems to identify novel inhibitors with improved specificity or reduced side effects.

  • Mechanism of action studies: The availability of purified recombinant VKORC1 enables detailed biochemical and biophysical analyses of drug-protein interactions, elucidating molecular mechanisms of inhibition.

  • Resistance mechanism investigation: Comparative studies between wild-type and mutant VKORC1 variants help explain clinically observed anticoagulant resistance and guide personalized medicine approaches.

Understanding VKORC1's catalytic mechanism through recombinant protein studies will continue to be crucial for developing next-generation anticoagulants with improved safety profiles and more predictable pharmacodynamics .

What technical challenges remain in VKORC1 research and how might they be addressed?

Despite significant advances, several technical challenges persist in VKORC1 research that require innovative approaches:

  • Structural determination: As an integral membrane protein, obtaining high-resolution structural data remains difficult. Emerging techniques like cryo-electron microscopy and advanced crystallization methods for membrane proteins offer promising avenues for progress.

  • In vitro reconstitution: Fully reconstituting the vitamin K cycle in vitro requires multiple components beyond VKORC1, including γ-glutamyl carboxylase and appropriate electron donors. Developing comprehensive reconstitution systems would enable more detailed mechanistic studies.

  • Species-specific differences: While bovine VKORC1 shares similarities with human VKORC1, species-specific differences in drug sensitivity and enzyme kinetics must be carefully considered when translating findings.

  • Redox partner identification: The physiological electron donor(s) for VKORC1 remain incompletely characterized. Proteomic and interactome approaches could help identify these critical components of the vitamin K cycle.

Addressing these challenges will require multidisciplinary approaches combining structural biology, enzymology, cell biology, and systems biology perspectives. The continued development of improved expression systems, purification protocols, and functional assays will be essential for advancing our understanding of this fascinating enzyme system.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.