Recombinant Bovine Voltage-dependent calcium channel gamma-3 subunit (CACNG3)

Shipped with Ice Packs
In Stock

Description

Molecular Structure and Composition

CACNG3 is an integral membrane protein belonging to the PMP-22/EMP/MP20 family. The bovine variant shares homology with human and other mammalian forms, featuring:

  • Primary Structure: A 315-amino acid sequence with a conserved transmembrane domain architecture .

  • Post-Translational Modifications: Produced in E. coli, it lacks eukaryotic modifications but retains functional epitopes for antibody generation .

  • Tags and Purification: Typically expressed with affinity tags (e.g., His-tag) for simplified purification via IMAC chromatography .

Functional Role in Calcium Signaling

CACNG3 stabilizes voltage-gated calcium channels in an inactivated state, regulating Ca²⁺ influx kinetics . In bovine systems, it likely interacts with:

  • L-Type Channels: Modulates high-voltage-activated (HVA) channels critical for muscle and endocrine functions .

  • AMPA Receptors: Enhances membrane trafficking and slows desensitization of glutamate receptors .

Interaction Partners (STRING Database)

ProteinFunctionInteraction Score
CACNA2D1Regulates calcium current density and channel kinetics0.978
GRIA2Mediates excitatory synaptic transmission0.923
CACNB4Modulates L-type channel activation/inactivation0.958

Recombinant Production

  • Expression: Optimized in E. coli for high yield (>85% purity via SDS-PAGE) .

  • Storage: Lyophilized or liquid form at -20°C to -80°C, with trehalose or glycerol buffers to prevent aggregation .

Research Applications

  • Antibody Development: Used as an antigen for generating anti-CACNG3 antibodies .

  • Channel Modulation Studies: Facilitates in vitro assays to probe calcium channel inactivation mechanisms .

  • Comparative Physiology: Enables cross-species analysis of VGCC regulatory mechanisms .

Challenges and Future Directions

  • Species-Specific Variations: Structural differences between bovine and human CACNG3 may affect translational research .

  • Functional Assays: Further studies are needed to characterize its role in bovine excitable tissues.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate special requests for the format. Please specify your preference in the order notes and we will do our best to meet your needs.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery timeframes, please contact your local distributors.
Note: Our proteins are typically shipped with standard blue ice packs. If you require dry ice shipping, please communicate this to us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default glycerol concentration is 50%, which can serve as a reference point.
Shelf Life
The shelf life of our products is influenced by various factors, including storage conditions, buffer components, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C, while lyophilized form can be stored for up to 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us and we will prioritize developing the specified tag.
Synonyms
CACNG3; Voltage-dependent calcium channel gamma-3 subunit; Neuronal voltage-gated calcium channel gamma-3 subunit; Transmembrane AMPAR regulatory protein gamma-3; TARP gamma-3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-315
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Names
Target Protein Sequence
MRMCDRGVQMLITTVGAFAAFSLMTIAVGTDYWLYSRGVCRTKSTSDNETSRKNEEVMTH SGLWRTCCLEGAFRGVCKKIDHFPEDADYEQDTAEYLLRAVRASSVFPILSVTLLFFGGL CVAASEFHRSRHNVILSAGIFFVSAGLSNIIGIIVYISANAGDPGQRDSKKSYSYGWSFY FGAFSFIIAEIVGVVAVHIYIEKHQQLRAKSHSELLKKSTFARLPPYRYRFRRRSSSRST EPRSRDLSPISKGFHTIPSTDISMFTLSRDPSKITMGTLLNSDRDHAFLQFHNSTPKEFK ESLHNNPANRRTTPV
Uniprot No.

Target Background

Function
This protein regulates the trafficking and gating properties of AMPA-selective glutamate receptors (AMPARs). It promotes their targeting to the cell membrane and synapses and modulates their gating properties by slowing their rates of activation, deactivation, and desensitization. This protein does not exhibit subunit-specific AMPA receptor regulation and regulates all AMPAR subunits. It is believed to stabilize the calcium channel in an inactivated (closed) state.
Database Links
Protein Families
PMP-22/EMP/MP20 family, CACNG subfamily
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the basic structure and function of CACNG3?

CACNG3 is a voltage-dependent calcium channel gamma-3 subunit that functions as an integral membrane protein. Its primary role is to stabilize calcium channels in an inactive (closed) state . Structurally, CACNG3 shares significant secondary structure similarities with other gamma subunits (γ1, γ2, γ4, and γ5), with greater sequence conservation in the transmembrane domains compared to other regions of the protein .

Hydrophobicity analysis reveals that γ2, γ3, and γ4 subunits exhibit higher structural similarity to each other than to γ1 or γ5, with γ5 showing an intermediate structure between γ1 and the others . These structural characteristics suggest selective conservation of transmembrane domains, indicating their functional importance in calcium channel regulation.

How does CACNG3 compare across different species?

For researchers working with bovine CACNG3, it's important to note that while species-specific differences exist, the core functional domains and transmembrane topology are likely conserved. This conservation allows for meaningful cross-species comparisons when studying fundamental aspects of CACNG3 function.

What cellular pathways involve CACNG3?

CACNG3 participates in several critical cellular pathways including:

  • Arrhythmogenic right ventricular cardiomyopathy (ARVC)

  • Cardiac muscle contraction

  • Dilated cardiomyopathy

  • Glutamate binding

  • Activation of AMPA receptors

  • Synaptic plasticity

The involvement of CACNG3 in these diverse pathways highlights its importance beyond simply regulating calcium channels, suggesting roles in both neuronal and cardiac function.

What is the tissue expression pattern of CACNG3?

CACNG3 expression has been detected primarily in neuronal tissues. Multiple expressed sequence tags (ESTs) corresponding to CACNG3 have been identified from fetal and adult brain tissue, with one cDNA derived from adult retina . This expression pattern suggests that CACNG3 functions primarily in neurons or glial cells.

Based on the available data, researchers studying bovine CACNG3 should expect similar neuronal expression patterns, with potential expression in the visual cortex as indicated by studies of mouse models focusing on the primary visual cortex (VISp or V1) .

How can I detect endogenous CACNG3 expression in tissue samples?

For detecting endogenous CACNG3 expression, several methodological approaches have proven effective:

  • RNA detection methods:

    • RT-PCR using primers corresponding to different exons (e.g., exon 3 and exon 4) to confirm transcription and proper mRNA processing

    • RNA in situ hybridization (ISH) for localized expression patterns in tissue sections

  • Protein detection methods:

    • Western blotting using commercially available antibodies against CACNG3

    • Immunohistochemistry for tissue localization

When designing primers for bovine CACNG3 detection, researchers should target conserved regions identified through cross-species sequence alignment to ensure specificity.

What are the best methods for isolating primary cells expressing CACNG3?

For isolating primary cells expressing CACNG3, researchers have successfully employed the following methodology based on cortical cell isolation techniques:

  • Freshly section brain tissue from the region of interest

  • Microdissect the full cortical depth or specific layers

  • Generate single-cell suspensions using enzymatic digestion

  • Isolate individual live cells by fluorescence-activated cell sorting (FACS)

  • Confirm CACNG3 expression using RT-PCR or immunostaining

This methodology has been validated for isolating specific neuronal populations from the mouse primary visual cortex and can be adapted for bovine tissue with appropriate species-specific modifications to the digestion protocols.

How can I optimize recombinant CACNG3 expression systems?

When working with recombinant bovine CACNG3, consider these methodological approaches:

  • Expression vector selection:

    • For structural studies: vectors with fusion tags (His, GST, or Fc-Avi) to facilitate purification

    • For functional studies: mammalian expression vectors that maintain post-translational modifications

  • Expression systems:

    • Mammalian cell lines (HEK293, CHO) for proper folding and post-translational modifications

    • Insect cell systems for higher yield while maintaining eukaryotic processing

  • Purification strategy:

    • Tandem affinity purification for higher purity

    • Size exclusion chromatography to separate monomeric from aggregated protein

Commercially available recombinant human CACNG3 preparations can serve as useful references for developing bovine-specific protocols .

How does CACNG3 contribute to calcium channel regulation?

CACNG3 plays a critical role in stabilizing calcium channels in their inactive (closed) state . Research methodologies to investigate this regulatory function include:

  • Electrophysiological approaches:

    • Patch-clamp recordings to measure calcium channel activity in the presence/absence of CACNG3

    • Current-voltage relationship analysis to determine voltage-dependent properties

  • Binding assays:

    • Co-immunoprecipitation to identify protein-protein interactions

    • Surface plasmon resonance to measure binding kinetics between CACNG3 and calcium channel components

  • Structural biology approaches:

    • Cryo-EM to visualize CACNG3 in complex with calcium channel subunits

    • Hydrogen-deuterium exchange mass spectrometry to identify interaction surfaces

These methodologies can reveal how bovine CACNG3 modulates calcium channel function and how this regulation may differ from other species.

What role does CACNG3 play in neurological disorders?

CACNG3 has been identified as a candidate gene for familial infantile convulsive disorder with paroxysomal choreoathetosis . Additionally, its similarity to the mouse stargazin protein (mutations in which are associated with absence seizures) suggests potential roles in epilepsy-related conditions .

Research approaches to investigate these connections include:

  • Genetic screening:

    • Sequencing CACNG3 in affected individuals and families

    • Analyzing single nucleotide polymorphisms and their correlation with disease phenotypes

  • Functional characterization:

    • Creating point mutations corresponding to disease-associated variants

    • Assessing the impact on calcium channel function using electrophysiological techniques

  • Animal models:

    • Developing CACNG3 knockout or knockin models

    • Characterizing neurological phenotypes and calcium channel function in these models

How can single-cell transcriptomics be used to study CACNG3 expression patterns?

Single-cell RNA sequencing has emerged as a powerful tool for studying gene expression at the individual cell level. Based on methodologies described in the literature, researchers can employ the following approach for bovine CACNG3:

  • Tissue preparation and dissociation:

    • Fresh tissue sectioning

    • Enzymatic dissociation to generate single-cell suspensions

  • Single-cell isolation:

    • FACS-based isolation of individual cells

    • Microfluidic-based cell capture systems

  • RNA processing:

    • Reverse transcription and amplification of full-length poly(A)-RNA using SMARTer protocol

    • Library preparation using tagmentation (e.g., Nextera XT)

  • Bioinformatic analysis:

    • Quality control filtering (>5,000,000 reads per cell recommended)

    • Dimensionality reduction using iterative principal component analysis (PCA)

    • Cell clustering using weighted gene coexpression network analysis (WGCNA)

    • Validation using machine learning methods (e.g., random forest)

This approach has successfully identified cell types expressing CACNG3 and related genes in mouse cortical tissue and can be adapted for bovine samples.

What quality control metrics should be monitored in single-cell CACNG3 expression studies?

When conducting single-cell studies involving CACNG3, researchers should monitor these key quality control metrics:

  • Sequencing depth:

    • Minimum of 5,000,000 total reads per cell

    • Median of approximately 8,700,000 reads per cell

  • Classification consistency:

    • Cells consistently classified into the same cluster ("core" cells)

    • Cells classified into more than one cluster ("intermediate" cells)

  • Expression of known markers:

    • For neuronal cells: Snap25+

    • For glutamatergic neurons: Slc17a7+, Gad1-

    • For GABAergic neurons: Slc17a7-, Gad1+

These quality control metrics ensure reliable identification of CACNG3-expressing cells and their proper classification within the broader cellular taxonomy.

How has the CACNG3 gene evolved in relation to other calcium channel subunits?

Phylogenetic analysis of the CACNG gene family reveals a complex evolutionary history requiring at least two ancient tandem duplications that preceded multiple chromosome duplication events . This evolutionary pattern explains the distribution of CACNG genes across different chromosomes.

For researchers studying bovine CACNG3, understanding this evolutionary context provides insights into potential functional specialization and conservation. Key methodological approaches include:

  • Comparative genomics:

    • Alignment of CACNG3 sequences across species

    • Analysis of syntenic regions to identify conserved gene clusters

  • Phylogenetic analysis:

    • Construction of phylogenetic trees using maximum likelihood methods

    • Estimation of divergence times for CACNG gene family members

The identification of paralogous protein kinase C genes (PRKCB1 and PRKCA) immediately telomeric of CACNG3 and CACNG5, respectively, provides further evidence of the evolutionary relationships between these chromosomal regions .

What is the relationship between CACNG3 and other gamma subunit proteins?

CACNG3 belongs to a family of five gamma subunit proteins (γ1-γ5). Comparative analysis reveals:

  • Structural relationships:

    • γ2, γ3, and γ4 show higher structural similarity to each other than to γ1 or γ5

    • γ5 exhibits an intermediate structure between γ1 and the others

  • Sequence conservation:

    • Greater amino acid identity within transmembrane domains

    • More divergent sequences in non-transmembrane regions

  • Expression patterns:

    • γ1 predominantly expressed in skeletal muscle

    • γ2, γ3, and γ4 primarily expressed in brain tissue

These relationships provide important context for researchers studying the specific functions of bovine CACNG3 within the broader calcium channel regulatory machinery.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.