Recombinant Bovine Williams-Beuren syndrome chromosomal region 28 protein homolog (WBSCR28)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference when placing your order. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs unless otherwise specified. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life for the liquid form is 6 months at -20°C/-80°C. For the lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing it accordingly.
Synonyms
TMEM270; Transmembrane protein 270
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-262
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Names
TMEM270
Target Protein Sequence
MEAIPLVRSSLSGTLLVVVKLSALLIQNRAHLYNFLLLKIFLFNHWLLGLTQEAQGFHPP SKIAGCPVGRVLWAGLTLLEVPVCLALRVPRLVWAGLLGCARALGLGPKWLGAWEQLGLS AATWTDLFLSCLHSLMLAALLLLLLVWRLYQKAQCCSLGRLPRKALLQNRVVRRSLALLK SLYWWVESTAALTSWHLAYLITWTTCLASHLLQAAFEHTAQLAQAQEAEPQKALGLSSET PPPGPPAPGARPVLPEPGTPGE
Uniprot No.

Target Background

Database Links
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is WBSCR28 and how does it relate to Williams-Beuren syndrome?

WBSCR28 (Williams-Beuren syndrome chromosomal region 28) is one of several genes located within the critical region on chromosome 7q11.23 that is typically deleted in Williams-Beuren syndrome. The gene encodes a protein with a sequence of 265 amino acids in humans, but its precise function remains under investigation . Williams-Beuren syndrome is a neurodevelopmental disorder characterized by supravalvular aortic stenosis, growth retardation, premature aging of the skin, intellectual disability, and dental malformations .

WBSCR28 is retained in the common 1.55-megabase deletion but is deleted in patients with the rarer 1.84-megabase deletions . This suggests that WBSCR28 might contribute to phenotypic differences observed between patients with different deletion sizes. The gene is part of a complex genomic architecture within the WBS critical region that has been subject to evolutionary rearrangements, including inversions and insertions of low-copy-number repeats during primate evolution .

What is the molecular structure and characterization of WBSCR28?

The human WBSCR28 protein consists of 265 amino acids with the following sequence:
MEALPPVRSSLLGNLLQVTRLSVLLVQNRDHLYNFLLLKINLFNHWVSGLAQEARGSCNWQAHLPLGAADCPLGQALRAGLALIQVPVWLVLQGPRLMWAGMWGSTKGLGLALLSAWEQLGLSVAIWTDLFLSCLHGLMLVALLLVVVTWRVCQKSHCFRLGRQLSKALQVNCVVRKLLVQLRRLYWWVETMTALTSWHLAYLITWTTCLASHLLQAAFEHTTQLAEAQEVEPQEVSGSSLLPSLSASSDSESGTVLPEQETPRE

The recombinant human protein has a molecular weight of approximately 55.8 kDa when expressed with a GST tag . Structurally, it appears to contain transmembrane domains, based on the presence of hydrophobic regions in its sequence, suggesting it may function as a membrane protein . The gene is also known by the alias MGC26719, and its Entrez Gene ID is 135886 .

Unlike other well-characterized genes in the WBS region such as GTF2I and GTF2IRD1, which contain helix-loop-helix domains (I repeats) and function as transcription factors, WBSCR28's structural motifs and functional domains have not been as thoroughly characterized .

What techniques are optimal for expressing and purifying recombinant bovine WBSCR28?

Based on protocols for human WBSCR28, the following methodology can be adapted for bovine WBSCR28:

Expression System Selection:
The wheat germ in vitro expression system has been successfully used for human WBSCR28 and could be adapted for the bovine homolog . This cell-free system offers advantages for proteins that may be difficult to express in bacterial systems due to toxicity, insolubility, or post-translational modifications.

Vector Design:

  • Clone the full-length bovine WBSCR28 ORF into an expression vector with an N-terminal GST tag

  • Include a TEV protease cleavage site if tag removal is desired

  • Verify the construct by sequencing before expression

Purification Protocol:

  • Express the protein in the selected system

  • Lyse cells under native conditions (50mM Tris-HCl, pH 8.0)

  • Purify using Glutathione Sepharose 4 Fast Flow affinity chromatography

  • Elute with 10mM reduced glutathione in 50mM Tris-HCl, pH 8.0

  • Analyze purity by SDS-PAGE (12.5%) with Coomassie Blue staining

  • Store at -80°C in aliquots to avoid repeated freeze-thaw cycles

For bovine-specific optimization, consider codon optimization for the expression system and testing different tags (His-tag, MBP) if GST affects solubility or function.

How can cross-species functional analysis of WBSCR28 contribute to understanding Williams-Beuren syndrome?

Cross-species functional analysis of WBSCR28 offers valuable insights into both evolutionary conservation and disease mechanisms:

Methodological Approach:

  • Sequence Comparison Analysis:

    • Align bovine, human, mouse, and other mammalian WBSCR28 sequences

    • Identify conserved domains that may indicate functional importance

    • Calculate evolutionary rates to detect regions under selective pressure

  • Functional Complementation Studies:

    • Express bovine WBSCR28 in human or mouse cell lines lacking endogenous WBSCR28

    • Assess rescue of phenotypes to determine functional conservation

    • Compare with human WBSCR28 to identify species-specific differences

  • Animal Model Development:

    • Generate knockout or transgenic models expressing bovine WBSCR28

    • Compare phenotypes with human WBSCR28 models or WBS patient data

    • Analyze developmental and physiological impacts

Analytical Framework:

Analysis TypeParametersExpected Outcomes
Sequence Conservation% identity, domain preservationFunctional prediction
Expression Profile ComparisonTissue distribution, developmental timingEvolutionary shifts in gene regulation
Protein Interaction NetworksCo-immunoprecipitation, Y2HSpecies-specific vs. conserved interactions
Phenotypic AnalysisCellular/organismal phenotypesFunctional conservation assessment

This approach enables researchers to distinguish between universal aspects of WBSCR28 function and species-specific adaptations, potentially revealing why certain features of Williams-Beuren syndrome are unique to humans .

What are the challenges in determining the contribution of WBSCR28 to Williams-Beuren syndrome phenotypes?

Several methodological challenges complicate the assessment of WBSCR28's specific role in Williams-Beuren syndrome:

Genomic Complexity:
The WBS critical region contains multiple genes that are co-deleted, making it difficult to isolate the effects of WBSCR28 alone. The region also contains complex structural features including low-copy repeats that can complicate genomic analysis .

Phenotypic Variability:
WBS presents with variable expressivity, and the rarer 1.84-megabase deletions that include WBSCR28 may have overlapping phenotypes with the more common 1.55-megabase deletions, making phenotype-genotype correlations challenging .

Model System Limitations:
Creating accurate animal models is complicated by evolutionary differences. The WBS chromosomal region has undergone significant rearrangements during primate evolution, including inversions and local reorganizations that may affect gene function and regulation .

Methodological Approaches to Address These Challenges:

  • Single-gene Models:

    • CRISPR/Cas9-mediated knockout of WBSCR28 in cellular and animal models

    • Conditional knockout systems to study temporal and tissue-specific effects

    • Rescue experiments with wild-type WBSCR28 to confirm phenotypic links

  • Patient-derived Systems:

    • iPSC lines from WBS patients with different deletion sizes

    • Differentiation into relevant cell types (neurons, cardiac cells)

    • Genomic editing to restore only WBSCR28 expression

  • Multi-omics Integration:

    • Transcriptomic analysis to identify downstream pathways

    • Proteomics to map interaction networks

    • Metabolomics to detect functional consequences

Recent studies have implicated other genes in the region, such as GTF2I and GTF2IRD2, in specific aspects of Williams-Beuren syndrome, including visual-spatial deficits and mental retardation . Similar approaches could be applied to determine WBSCR28's contribution.

How can ELISA assays be optimized for detection of bovine WBSCR28?

While commercial ELISA kits are available for human WBSCR28 , optimizing these assays for bovine WBSCR28 requires careful consideration:

Antibody Development and Validation:

  • Generate antibodies against synthetic peptides from conserved regions of bovine WBSCR28

  • Validate antibody specificity using recombinant bovine WBSCR28

  • Test cross-reactivity with human WBSCR28 and other potential interfering proteins

ELISA Protocol Optimization:

  • Capture Antibody Selection:

    • Test polyclonal vs. monoclonal antibodies for optimal sensitivity

    • Determine optimal coating concentration (typically 1-10 μg/ml)

    • Evaluate coating buffers for maximum binding efficiency

  • Standard Curve Development:

    • Use purified recombinant bovine WBSCR28 with GST-tag

    • Establish a dilution series (typically 0-1000 ng/ml)

    • Determine limit of detection and quantification

  • Sample Preparation:

    • Optimize extraction buffers for different tissue types

    • Evaluate need for pre-clearing steps to remove interfering substances

    • Determine optimal dilution factors for different sample types

  • Detection System:

    • Compare direct vs. sandwich ELISA formats

    • Test HRP-conjugated vs. fluorescent detection systems

    • Evaluate signal amplification methods for low-abundance samples

Validation Parameters:

ParameterAcceptance CriteriaMethod
SpecificityNo cross-reactivity with related proteinsWestern blot confirmation
SensitivityLOD < 10 ng/mlSerial dilution analysis
PrecisionCV < 15%Intra/inter-assay variation
Recovery80-120%Spike-and-recovery experiments
LinearityR² > 0.98Dilution linearity tests

For bovine-specific applications, researchers should verify that the antibodies recognize conserved epitopes and optimize reaction conditions based on the physicochemical properties of the bovine homolog.

What approaches are most effective for studying protein-protein interactions involving WBSCR28?

Understanding the interactome of WBSCR28 is crucial for elucidating its function. Based on studies of other Williams-Beuren syndrome region proteins, the following approaches are recommended:

In Vitro Interaction Methods:

  • Pull-down Assays:

    • Express GST-tagged bovine WBSCR28 as bait protein

    • Incubate with tissue or cell lysates

    • Identify interacting partners by mass spectrometry

    • Validate with reciprocal pull-downs using identified partners

  • Surface Plasmon Resonance (SPR):

    • Immobilize purified WBSCR28 on sensor chip

    • Measure binding kinetics with candidate interactors

    • Determine kon, koff, and KD values

    • Compare with human WBSCR28 interaction profiles

Cellular Interaction Methods:

  • Co-immunoprecipitation (Co-IP):

    • Express tagged bovine WBSCR28 in relevant cell types

    • Immunoprecipitate using tag antibodies

    • Identify co-precipitating proteins by Western blot or mass spectrometry

    • Confirm with reverse Co-IP experiments

  • Proximity Labeling:

    • Fuse WBSCR28 with BioID or APEX2

    • Express in cells and activate labeling

    • Purify biotinylated proximal proteins

    • Identify by mass spectrometry

Members of the GTF2I family in the Williams-Beuren syndrome region interact with various factors including PIASxβ, HDAC3, HDAC1, HDAC2, BHC110, MEF2C, NcoR, and retinoblastoma protein . Similar interaction studies with WBSCR28 could reveal whether it participates in related or distinct pathways.

Data Analysis Framework:

  • Categorize identified interactors by cellular compartment and function

  • Compare interactomes between species to identify conserved interactions

  • Map interactions to known pathways affected in Williams-Beuren syndrome

  • Prioritize interactions for functional validation

This systematic approach will help build a comprehensive interaction network for WBSCR28 and provide insights into its potential role in Williams-Beuren syndrome pathophysiology.

How should researchers interpret WBSCR28 expression data in the context of Williams-Beuren syndrome?

Interpreting WBSCR28 expression data requires careful consideration of multiple factors:

Context-Dependent Analysis Framework:

  • Developmental Timing:

    • Compare expression across developmental stages

    • Correlate with the emergence of WBS-related phenotypes

    • Analyze in the context of critical developmental windows

  • Tissue Specificity:

    • Prioritize analysis in tissues affected in WBS (brain, heart, connective tissue)

    • Consider cell type-specific expression within heterogeneous tissues

    • Compare with expression patterns of other WBS region genes

  • Genetic Background Effects:

    • Analyze expression in the context of hemizygosity (as in WBS patients)

    • Consider possible compensatory expression from other genes

    • Evaluate potential modifier genes that affect expression variability

Methodological Considerations:

When analyzing RNA-seq or qPCR data, researchers should:

  • Normalize WBSCR28 expression to multiple reference genes for reliability

  • Compare absolute expression levels across tissues to identify primary sites of action

  • Consider allele-specific expression analysis to detect regulatory effects

  • Integrate with epigenetic data (chromatin accessibility, histone modifications) to understand regulatory mechanisms

Comparative Approach:

Analysis TypeComparisonInterpretation
Cross-speciesBovine vs. human expressionEvolutionary conservation of function
Cross-genotypeWBS patients vs. controlsDirect disease relevance
Cross-tissueNeural vs. non-neural tissuesTissue-specific requirements
TemporalEmbryonic vs. adult expressionDevelopmental role

Other genes in the Williams-Beuren syndrome region show dynamic expression patterns during development, which may provide clues about coordinated regulation . Integration of WBSCR28 expression data with these patterns could reveal functional relationships and gene regulatory networks affected in the syndrome.

What statistical approaches are most appropriate for analyzing WBSCR28 functional data?

Analyzing functional data for WBSCR28 requires robust statistical approaches tailored to the experimental design:

Experimental Design Considerations:

  • Power Analysis:

    • Determine appropriate sample sizes based on expected effect sizes

    • Consider biological variability within and between species

    • Adjust for multiple testing when examining multiple phenotypes

  • Appropriate Controls:

    • Include wild-type and heterozygous models to mirror WBS hemizygosity

    • Use multiple reference genes/proteins for normalization

    • Include species-matched controls when comparing bovine and human WBSCR28

Statistical Methods by Data Type:

  • Gene Expression Analysis:

    • Use linear mixed models to account for technical and biological variability

    • Apply FDR correction for multiple testing in genome-wide analyses

    • Consider Bayesian approaches for small sample sizes

  • Protein Interaction Data:

    • Apply significance analysis of interactome (SAINT) algorithm

    • Use permutation tests to establish confidence thresholds

    • Implement network analysis methods to identify significant interaction clusters

  • Phenotypic Analyses:

    • Use ANOVA with post-hoc tests for continuous variables

    • Apply non-parametric tests for non-normally distributed data

    • Consider longitudinal analysis methods for developmental studies

Data Integration Approaches:

For comprehensive understanding, researchers should integrate:

  • Transcriptomic, proteomic, and interactomic data

  • Phenotypic measurements from multiple systems

  • Evolutionary conservation data across species

Since GTF2IRD2 and GTF2I have been implicated in specific aspects of Williams-Beuren syndrome (visual-spatial functioning and mental retardation, respectively) , similar statistical approaches could be applied to determine whether WBSCR28 contributes to specific phenotypic aspects of the syndrome.

What novel approaches could advance our understanding of WBSCR28 function?

Several cutting-edge approaches could significantly enhance our understanding of WBSCR28:

Advanced Genomic Approaches:

  • Single-cell Transcriptomics:

    • Map cell type-specific expression patterns in affected tissues

    • Identify cell populations most sensitive to WBSCR28 dosage

    • Track developmental trajectories in normal and WBS models

  • Spatial Transcriptomics:

    • Visualize WBSCR28 expression in tissue context

    • Correlate with anatomical features affected in WBS

    • Integrate with protein localization data

Functional Genomics:

  • CRISPR Screening:

    • Perform genome-wide CRISPR screens in WBSCR28-expressing cells

    • Identify genetic interactions and modifiers

    • Discover pathways functionally connected to WBSCR28

  • Organoid Models:

    • Generate cerebral or cardiac organoids with WBSCR28 modifications

    • Study developmental impacts in 3D tissue context

    • Compare human and bovine WBSCR28 effects on organoid development

Structural Biology:

  • Cryo-EM or X-ray Crystallography:

    • Determine the 3D structure of WBSCR28

    • Identify potential functional domains

    • Guide rational design of functional studies

  • Molecular Dynamics Simulations:

    • Model protein behavior in membrane environments

    • Predict effects of sequence variations between species

    • Identify potential ligand binding sites

The Williams-Beuren syndrome chromosomal region has been subject to complex evolutionary changes, including inversions and local rearrangements . Modern genomic approaches could help understand how these structural changes affect WBSCR28 function and contribute to species-specific aspects of Williams-Beuren syndrome.

How might bovine WBSCR28 studies inform therapeutic approaches for Williams-Beuren syndrome?

Comparative studies of bovine and human WBSCR28 could provide unique insights for therapeutic development:

Translational Research Framework:

  • Functional Conservation Analysis:

    • Identify conserved domains essential for function

    • Determine whether bovine WBSCR28 can functionally complement human deficiency

    • Use conservation data to prioritize therapeutic targets

  • Cross-species Disease Modeling:

    • Develop bovine cell and animal models

    • Compare phenotypes with human models

    • Identify species-specific differences that might explain variable presentation

  • Therapeutic Screening Platforms:

    • Use bovine and human cellular models for parallel screening

    • Identify compounds effective across species (higher likelihood of conserved mechanisms)

    • Test interventions at different developmental stages

Potential Therapeutic Approaches:

ApproachMechanismResearch Application
Gene TherapyWBSCR28 replacementTest in cellular and animal models
Small MoleculesModulate WBSCR28 pathwaysScreen using parallel bovine/human systems
Antisense OligonucleotidesModify expression of compensatory genesTarget conserved regulatory sequences
Protein ReplacementRecombinant WBSCR28 deliveryCompare efficacy of bovine vs. human protein

The contribution of different genes to the WBS phenotype remains under investigation, with recent studies implicating GTF2IRD2 and GTF2I in visual-spatial functioning and mental retardation . Determining whether WBSCR28 contributes to specific aspects of the syndrome could enable more targeted therapeutic approaches.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.