Recombinant Bovine Zinc transporter 7 (SLC30A7)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery details.
Important: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple uses, aliquoting is essential. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
SLC30A7; ZNT7; Zinc transporter 7; ZnT-7; Solute carrier family 30 member 7
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-376
Protein Length
Full length protein
Species
Bos taurus (Bovine)
Target Names
Target Protein Sequence
MLPLSIKDDEYKPPKFNLFRKISGWFRSILSDKTSRNLFFFLCLNLSFAFVELLYGIWSN CLGLISDSFHMFFDSTAILAGLAASVISKWRDNDAFSYGYVRAEVLAGFVNGLFLIFTAF FIFSEGVERALAPPDVHHERLLLVSILGFVVNLVGIFVFKHGGHGHSHGSGHGHSHSLFN GALDQTHGHGDHCHSHELKHGAAHSHDHAHGHGHFHSHDGPSLKETTGPSRQILQGVFLH ILADTLGSIGVIASAIMMQNFGLMIADPICSILIAMLIVISVIPLLRESVGILMQRTPPL LENTLPQCYQRVQQLQGVYSLQEQHFWTLCSDVYVGTLKLVVAPDADARWILSQTHNIFT QAGVRQLYVQIDFAAM
Uniprot No.

Target Background

Function
SLC30A7, also known as Zinc transporter 7, appears to facilitate the movement of zinc from the cytoplasm into the Golgi apparatus. It plays a partial role in regulating cellular zinc homeostasis. SLC30A7, in conjunction with ZNT5, is required for the activation of zinc-dependent enzymes, alkaline phosphatases (ALPs). It transports zinc into the lumens of the Golgi apparatus and vesicular compartments, where ALPs reside, facilitating the conversion of apoALPs to holoALPs. SLC30A7, alongside ZNT5 and ZNT6, is crucial for the activation of TNAP.
Database Links
Protein Families
Cation diffusion facilitator (CDF) transporter (TC 2.A.4) family, SLC30A subfamily
Subcellular Location
Golgi apparatus, trans-Golgi network membrane; Multi-pass membrane protein.

Q&A

What is SLC30A7 and what is its primary function?

SLC30A7, also known as ZNT7 or ZnT-7, is a member of the solute carrier family 30 of zinc transporters. It functions primarily to transport zinc ions across biological membranes, specifically facilitating zinc efflux from the cytoplasm into intracellular compartments or extracellular space. In mammalian systems including bovine tissues, SLC30A7 plays a critical role in zinc homeostasis, which is essential for numerous cellular processes including enzyme activity, protein structure, and gene expression regulation .

How is recombinant bovine SLC30A7 typically produced?

Recombinant bovine SLC30A7 can be produced using several expression systems including:

  • E. coli bacterial expression systems

  • Yeast expression systems

  • Baculovirus-infected insect cell systems

  • Mammalian cell expression systems

  • Cell-free expression systems

The choice of expression system depends on research requirements for protein folding, post-translational modifications, and functional activity. Current production methods typically yield greater than 85% purity as determined by SDS-PAGE analysis .

What are the common applications of recombinant bovine SLC30A7 in research?

Recombinant bovine SLC30A7 is utilized in various research applications including:

  • Functional characterization of zinc transport mechanisms

  • Protein-protein interaction studies

  • Antibody production and validation

  • Structural biology investigations

  • Comparative studies of zinc transport across species

  • Development of transport inhibitors or enhancers

The high purity recombinant protein (≥85%) provides a reliable tool for these applications, particularly when native protein isolation presents challenges .

How should researchers determine the optimal conditions for SLC30A7 functional assays?

When designing functional assays for SLC30A7, researchers should consider:

  • Buffer composition: Zinc transport activity is highly dependent on pH and ionic strength. A systematic evaluation of buffers (pH range 6.0-8.0) should be conducted.

  • Zinc concentration: Determine the Km value through titration experiments using 0.1-100 μM zinc concentrations.

  • Temperature optimization: Assess activity at 25°C, 30°C, and 37°C to determine optimal temperature.

  • Membrane reconstitution: For transport studies, the recombinant protein must be properly incorporated into liposomes or membrane systems.

  • Detection methods: Utilize zinc-specific fluorescent probes (e.g., FluoZin-3) or radioactive 65Zn for quantitative transport measurements.

A methodical approach testing these parameters will establish reliable baseline conditions for subsequent experimental work with bovine SLC30A7 .

What controls should be included when validating recombinant bovine SLC30A7 activity?

A comprehensive validation protocol should include:

  • Negative controls:

    • Heat-inactivated SLC30A7 protein

    • Transport-deficient SLC30A7 mutants

    • Buffer-only conditions

  • Positive controls:

    • Known functional zinc transporters (e.g., human SLC30A7)

    • Zinc ionophores (e.g., pyrithione) to establish maximum transport rates

  • Specificity controls:

    • Competition assays with other divalent metals (Ca2+, Mg2+, Cu2+)

    • SLC30A7-specific inhibitors when available

  • System validation:

    • Demonstration of zinc-dependent enzyme activation in reconstituted systems

    • Vesicular zinc accumulation assays

This validation framework ensures that observed activities can be specifically attributed to the recombinant bovine SLC30A7 protein .

How can recombinant bovine SLC30A7 be used to investigate zinc homeostasis mechanisms in bovine mammary epithelial cells?

To investigate zinc homeostasis in bovine mammary epithelial cells using recombinant SLC30A7:

  • Cellular localization studies:

    • Transfect cells with tagged recombinant SLC30A7

    • Perform immunofluorescence to determine subcellular localization

    • Compare localization patterns during different lactation stages

  • Functional knockdown/overexpression:

    • Use CRISPR-Cas9 to generate SLC30A7 knockout cell lines

    • Establish stable overexpression lines with recombinant SLC30A7

    • Compare zinc transport kinetics between modified and wild-type cells

  • Zinc flux measurements:

    • Load cells with zinc-sensitive fluorophores

    • Monitor real-time changes in zinc concentration

    • Correlate flux with SLC30A7 expression levels

  • Transcriptional regulation analysis:

    • Identify conditions that alter SLC30A7 expression

    • Characterize promoter elements using reporter assays

    • Determine transcription factors regulating expression

This multifaceted approach will provide insights into how SLC30A7 contributes to zinc regulation in the bovine mammary gland, which has implications for milk production and quality .

What structural features of bovine SLC30A7 can be investigated using the recombinant protein?

Structural investigations of recombinant bovine SLC30A7 can focus on:

  • Transmembrane topology:

    • Cysteine scanning mutagenesis to map membrane-spanning regions

    • Protease protection assays to identify cytoplasmic and luminal domains

    • Generation of topology models through computational prediction validated by experimental data

  • Functional domains:

    • Site-directed mutagenesis of predicted zinc-binding residues

    • Creation of chimeric proteins with other ZnT family members

    • Evaluation of conserved domains across species

  • Post-translational modifications:

    • Identification of glycosylation sites using deglycosylation enzymes

    • Analysis of phosphorylation sites through mass spectrometry

    • Determination of how modifications affect transport activity

  • Oligomerization states:

    • Size exclusion chromatography to determine native complex size

    • Blue native PAGE analysis of purified protein

    • Cross-linking studies to identify interaction interfaces

These structural analyses provide crucial insights into the mechanism of zinc transport and species-specific differences that might inform bovine-specific applications .

How does bovine SLC30A7 differ from other members of the SLC30 family?

Bovine SLC30A7 exhibits several distinguishing characteristics compared to other SLC30 family members:

FeatureSLC30A7 (ZnT7)Other ZnT TransportersFunctional Implications
Subcellular LocalizationPrimarily Golgi apparatusZnT1: Plasma membrane
ZnT2, ZnT3, ZnT4: Vesicular
ZnT5, ZnT6: Golgi/vesicular
ZnT8: Secretory vesicles
ZnT9, ZnT10: Various
Determines zinc distribution within cellular compartments
Tissue ExpressionWidespread, high in secretory tissuesVarying tissue-specific patternsInfluences tissue-specific zinc homeostasis
Transport DirectionCytoplasm to Golgi lumenAll ZnTs: Cytoplasm to organelles or extracellular spaceAffects cellular zinc redistribution
RegulationResponsive to zinc statusVariable zinc-responsivenessDetermines adaptability to zinc fluctuations
OligomerizationForms homodimersMost form homo/heterodimersImpacts transport efficiency and regulation

These differences highlight the specialized function of SLC30A7 in maintaining Golgi zinc levels, which is crucial for zinc-dependent enzymes residing in this compartment .

How can researchers distinguish between the activities of SLC30A7 and SLC39A7 (ZIP7) in experimental systems?

Distinguishing between SLC30A7 (ZnT7) and SLC39A7 (ZIP7) activities requires careful experimental design:

  • Opposite transport directionality:

    • ZnT7 transports zinc out of cytoplasm into Golgi

    • ZIP7 transports zinc into cytoplasm from organelles

    • Design zinc flux assays that specifically measure directional transport

  • Subcellular localization differences:

    • Use compartment-specific zinc probes to distinguish Golgi (ZnT7) from ER (ZIP7) zinc levels

    • Perform co-localization studies with organelle markers

  • Selective inhibition:

    • Develop transport assays with selective inhibitors when available

    • Use RNA interference to selectively suppress each transporter

  • Expression analysis:

    • Quantify relative expression of both transporters in the experimental system

    • Create systems with controlled expression of one transporter while suppressing the other

  • Zinc-dependent phenotypes:

    • Monitor cellular processes known to depend specifically on either Golgi or ER zinc pools

    • Assess rescue of deficiency phenotypes with specific transporters

These approaches help researchers attribute observed effects to the appropriate zinc transporter in complex biological systems .

What are the common pitfalls in purification of recombinant bovine SLC30A7 and how can they be addressed?

Purification of recombinant bovine SLC30A7 presents several challenges:

  • Membrane protein solubilization:

    • Challenge: Poor solubility in standard buffers

    • Solution: Systematic screening of detergents (DDM, LMNG, CHAPS) at various concentrations; use of amphipols for stabilization

  • Protein aggregation:

    • Challenge: Formation of inactive aggregates during purification

    • Solution: Addition of zinc (1-5 μM) in all buffers; inclusion of glycerol (10-20%); purification at 4°C

  • Low expression yields:

    • Challenge: Insufficient protein quantities for experimental work

    • Solution: Optimization of codon usage; use of fusion tags (MBP, SUMO); testing multiple expression systems

  • Proteolytic degradation:

    • Challenge: Protein instability during purification

    • Solution: Addition of protease inhibitor cocktails; reduction of purification time; engineering of more stable constructs

  • Loss of transport activity:

    • Challenge: Purified protein lacks functional activity

    • Solution: Gentle purification conditions; addition of lipids during purification; reconstitution into nanodiscs or liposomes

Implementation of these strategies typically results in protein preparations with ≥85% purity and preserved functional activity .

How can researchers effectively validate antibodies against bovine SLC30A7 for research applications?

A comprehensive antibody validation protocol for bovine SLC30A7 should include:

  • Specificity testing:

    • Western blot analysis comparing wild-type and SLC30A7-knockout samples

    • Immunoprecipitation followed by mass spectrometry identification

    • Peptide competition assays using the immunizing antigen

    • Cross-reactivity assessment with other ZnT family members

  • Application-specific validation:

    • For immunohistochemistry: Comparison with mRNA expression patterns

    • For flow cytometry: Parallel analysis with fluorescent protein-tagged SLC30A7

    • For immunoprecipitation: Confirmation of interaction partners

  • Cross-species reactivity:

    • Testing antibody recognition of recombinant SLC30A7 from multiple species

    • Epitope conservation analysis across species

    • Validation in tissues from different species

  • Lot-to-lot consistency:

    • Standardized testing protocol for each new antibody lot

    • Creation of reference samples for comparative analysis

    • Quantitative assessment of binding parameters

This validation framework ensures reliable antibody performance across research applications and minimizes false results due to antibody limitations .

How should researchers interpret contradictory results in SLC30A7 functional studies?

When encountering contradictory results in SLC30A7 studies, researchers should systematically:

  • Evaluate methodological differences:

    • Compare protein preparation methods (expression systems, purification protocols)

    • Assess differences in assay conditions (buffer composition, temperature, pH)

    • Examine detection methods and their sensitivities

  • Consider biological variables:

    • Analyze cell type or tissue-specific factors that might influence transporter function

    • Evaluate the presence of endogenous interacting partners or regulators

    • Assess zinc status of experimental systems

  • Examine species-specific variations:

    • Compare sequence homology between bovine SLC30A7 and other studied orthologs

    • Identify critical residues that differ between species

    • Perform comparative functional studies

  • Resolve contradictions through integrated approaches:

    • Design experiments that directly address conflicting results

    • Utilize multiple complementary techniques to evaluate the same parameter

    • Collaborate with laboratories reporting different outcomes to standardize protocols

This systematic approach helps distinguish genuine biological complexity from technical artifacts in seemingly contradictory results .

What bioinformatic approaches can enhance the analysis of SLC30A7 structure-function relationships?

Advanced bioinformatic strategies for SLC30A7 analysis include:

  • Homology modeling:

    • Generate structural models based on crystallized transporters

    • Refine models using molecular dynamics simulations

    • Validate predictions through experimental mutagenesis

  • Evolutionary analysis:

    • Perform phylogenetic comparisons across species

    • Identify conserved motifs through multiple sequence alignments

    • Calculate selection pressures on specific domains

  • Protein-protein interaction prediction:

    • Use algorithms to predict interaction interfaces

    • Identify potential regulatory binding partners

    • Model oligomerization interfaces

  • Molecular docking simulations:

    • Model zinc binding sites and transport pathway

    • Predict effects of mutations on transport efficiency

    • Identify potential allosteric sites

  • Systems biology integration:

    • Map SLC30A7 within zinc homeostasis networks

    • Predict cellular responses to transporter modulation

    • Identify compensatory mechanisms for transporter dysfunction

These computational approaches generate testable hypotheses about SLC30A7 function and guide experimental design for mechanistic studies .

What emerging technologies might advance our understanding of bovine SLC30A7 function?

Several cutting-edge technologies show promise for SLC30A7 research:

  • Cryo-electron microscopy:

    • High-resolution structural determination of the transporter in different conformational states

    • Visualization of zinc binding and transport mechanism

    • Structural basis for oligomerization and regulation

  • Single-molecule transport assays:

    • Real-time observation of individual transport events

    • Determination of transport stoichiometry and kinetics

    • Analysis of conformational dynamics during transport

  • Genome editing technologies:

    • Creation of precise bovine-specific mutations using CRISPR-Cas9

    • Development of reporter knock-ins for endogenous expression monitoring

    • Generation of tissue-specific conditional knockouts

  • Advanced imaging techniques:

    • Super-resolution microscopy of transporter trafficking

    • Multiplexed imaging of zinc dynamics and transporter localization

    • Correlative light and electron microscopy of transporter distribution

  • Organoid technology:

    • Functional studies in bovine tissue-specific organoids

    • Evaluation of transporter function in physiologically relevant systems

    • Disease modeling in organoids derived from different genetic backgrounds

These technologies promise to resolve long-standing questions about SLC30A7 function and regulation in bovine systems .

How might comparative studies between bovine and human SLC30A7 inform therapeutic development?

Comparative studies between bovine and human SLC30A7 offer several translational insights:

  • Conservation analysis:

    • Identification of functionally critical domains through cross-species comparison

    • Recognition of species-specific adaptations in transporter function

    • Determination of evolutionary constraints on transporter structure

  • Transport mechanism variations:

    • Comparison of transport kinetics between species

    • Identification of species-specific regulatory mechanisms

    • Analysis of differential responses to inhibitors or activators

  • Disease-associated mutations:

    • Examination of naturally occurring variants in bovine populations

    • Modeling of human disease mutations in bovine SLC30A7

    • Correlation of genotype with phenotypic manifestations across species

  • Therapeutic target assessment:

    • Evaluation of bovine models for human zinc transport disorders

    • Identification of conserved druggable sites on the transporter

    • Testing of therapeutic candidates in bovine cell systems before human trials

These comparative approaches leverage bovine systems as models for understanding fundamental aspects of zinc transport while identifying potential therapeutic strategies for human zinc-related disorders .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.