Recombinant Bovine Zinc transporter ZIP11 (SLC39A11)

What is ZIP11 and how does it function in zinc transport?

ZIP11, also known as SLC39A11, belongs to the broader ZIP family of multi-transmembrane domain metal ion transporters. Unlike the ZnT (SLC30) family that promotes zinc efflux from cells or into intracellular vesicles, ZIP proteins generally transport metal ions from the cell exterior or lumen of intracellular organelles into the cytoplasm. This directional transport helps maintain appropriate intracellular zinc concentrations, which are essential for cell growth, development, and differentiation .

To study ZIP11 function, researchers typically employ radioactive or fluorescent zinc tracking in cells expressing wild-type or mutant transporters. Subcellular fractionation followed by atomic absorption spectroscopy (AAS) can quantify zinc distribution across cellular compartments, providing insights into transporter activity.

How many isoforms of ZIP11 exist and how do they differ functionally?

At least three isoforms of ZIP11 are known to exist . These isoforms likely differ in their subcellular localization, tissue expression patterns, and potentially in their substrate specificity or transport kinetics.

To differentiate between isoforms in experimental settings, researchers should:

• Design isoform-specific primers for RT-PCR and qPCR

• Use isoform-specific antibodies for Western blotting and immunofluorescence

• Consider the impact of isoform variations when interpreting phenotypic data from knockdown or overexpression studies

• Document which isoform is being used in recombinant protein studies

What are the key structural elements of ZIP11 that enable zinc transport?

ZIP11 contains multiple transmembrane domains forming a helix bundle, with three critical metal binding sites (MBS) positioned within the transmembrane region: H204, E208, and E244. These residues are essential for metal transport and align with corresponding residues in other zinc transporters, such as BbZIP4 from B. bronchiseptica .

The proposed transport mechanism involves a binuclear metal center where:

• H204 corresponds to H177 in BbZIP4, which helps release metals from the M1 site

• E208 aligns with E181 in BbZIP4

• E244 corresponds to E211 in BbZIP4

• E208 and E244 likely connect two metal ions at M1 and M2 of the binuclear center, facilitating transport and release into the cytosol

What methods are optimal for studying ZIP11 localization and trafficking?

For effective visualization and tracking of ZIP11 in cellular contexts:

• Immunofluorescence microscopy: Use specific antibodies against ZIP11 or epitope-tagged recombinant proteins combined with organelle markers.

• Live-cell imaging: Generate fluorescent protein-tagged ZIP11 constructs to monitor real-time trafficking.

• Subcellular fractionation: Separate cellular compartments (nuclear, cytosolic, membrane, organellar) followed by Western blotting to detect relative ZIP11 distribution.

• Surface biotinylation assays: Quantify plasma membrane expression of ZIP11.

Important consideration: When working with tagged ZIP11 constructs, verify that the tag doesn't interfere with protein localization, as research has shown ZIP11 may localize to both plasma membrane and intracellular compartments including the Golgi apparatus .

How can I effectively measure zinc transport by recombinant ZIP11 in different experimental systems?

Several complementary approaches can be employed to measure ZIP11-mediated zinc transport:

• Atomic absorption spectroscopy (AAS): Quantify zinc content in subcellular fractions from cells expressing wild-type or mutant ZIP11. This method has successfully demonstrated that ZIP11 knockdown results in nuclear zinc accumulation, which can be rescued by wild-type ZIP11 but not by certain mutants .

• Fluorescent zinc indicators: Use zinc-specific probes (FluoZin-3, Zinpyr-1) combined with microscopy or flow cytometry to measure dynamic changes in free zinc concentrations.

• Radioisotope transport assays: Measure ^65Zn uptake in cells or proteoliposomes containing recombinant ZIP11.

• Zinc-dependent reporter systems: Engineer cells with zinc-responsive transcriptional reporters to indirectly measure zinc transport.

Analysis should include appropriate controls:

• Cells expressing vector alone

• Cells expressing known transport-deficient ZIP11 mutants (H204A, E208A, E244A)

• Treatment with zinc chelators or zinc ionophores as negative and positive controls

What are the best approaches for generating and validating ZIP11 knockout or knockdown models?

Based on research experience with ZIP11:

• Selection of genetic manipulation strategy:

  • Complete knockout via CRISPR/Cas9 may result in non-viable cells, as observed in HeLa cells

  • shRNA-mediated knockdown targeting the 3' UTR is preferable, allowing subsequent rescue experiments with exogenous wild-type or mutant ZIP11

• Validation of knockdown efficiency:

  • Confirm reduction at both mRNA (RT-qPCR) and protein (Western blot) levels

  • Assess functional consequences through zinc distribution analysis using AAS

• Rescue experiments:

  • Reintroduce wild-type or mutant ZIP11 to confirm specificity of phenotypes

  • Use vectors lacking the shRNA target sequence (e.g., by targeting 3' UTR in knockdown but using coding-sequence-only for rescue)

• Phenotypic characterization:

  • Measure proliferation, migration, and invasion capacities

  • Assess zinc distribution across subcellular compartments

  • Evaluate cellular morphology and senescence markers

How do specific mutations in ZIP11 affect its zinc transport function?

Studies have identified several key mutations that affect ZIP11 function with varying effects on zinc transport:

The mutations A234P and P243S have the strongest biological effects, likely due to their proximity to the substrate-binding region. These mutations may alter the electrostatic interactions among metal binding sites, promoting metal release and rearrangement of the transmembrane domains, potentially leading to greater accessibility for zinc transport .

What methods can be used to analyze the relationship between ZIP11 structure and function?

To effectively analyze ZIP11 structure-function relationships:

• Site-directed mutagenesis: Generate systematic mutations in:

  • Metal binding residues (H204, E208, E244)

  • Residues implicated in disease (A26S, A89V, A234P, P243S)

  • Conserved residues identified through sequence alignment with other ZIP family members

• Homology modeling and molecular dynamics simulations: Use structures of related transporters (like BbZIP4) to predict structural changes induced by mutations. The alignment between human ZIP11 and BbZIP4 has successfully identified conserved metal binding residues .

• Functional assays:

  • Measure zinc transport using methods outlined in FAQ 2.2

  • Assess protein expression, subcellular localization, and stability

  • Evaluate effects on cellular phenotypes (proliferation, migration, invasion)

• Structure determination:

  • X-ray crystallography or cryo-EM of purified recombinant ZIP11

  • Cross-linking mass spectrometry to identify residue proximity

  • FRET-based approaches to analyze conformational changes during transport

What is known about the specific amino acid sequence involved in zinc binding, and how can I use this information in my research?

The recombinant human ZIP11 control fragment (amino acids 222-264) has the sequence: TASATFESARNLAIGIGIQNFPEGLAVSLPLRGAGFSTWRAFW . Critical metal binding sites include:

• H204: Corresponds to H177 in BbZIP4, involved in releasing metal from M1 site

• E208: Corresponds to E181 in BbZIP4, part of a binuclear metal center

• E244: Corresponds to E211 in BbZIP4, part of a binuclear metal center

This information can be applied in research through:

• Design of peptide inhibitors: Creating peptides that mimic metal-binding regions to competitively inhibit zinc transport.

• Structure-guided mutagenesis: Beyond individual residue mutations, consider double or triple mutations to analyze cooperative effects.

• Drug discovery: Use the metal-binding pocket structure as a target for small molecule screening.

• Blocking experiments: Use recombinant protein fragments containing these sequences with corresponding antibodies to verify specificity in experimental applications .

How is ZIP11 expression altered in different cancer types, and what methodologies can detect these changes?

Research has revealed distinct patterns of ZIP11 expression across cancer types:

To effectively analyze ZIP11 expression in cancer samples:

• Transcriptomic analysis:

  • RNA-seq or microarray data from tumor vs. normal tissue

  • qRT-PCR validation of expression changes

  • Analysis of isoform-specific expression patterns

• Protein detection:

  • Immunohistochemistry on tissue microarrays

  • Western blotting of tumor lysates

  • Flow cytometry for single-cell analysis

• Mutation screening:

  • Targeted sequencing of SLC39A11 to identify SNPs (like A26S, A89V, A234P, P243S)

  • Analysis of mutation impact on protein function using cell models

• Clinical correlation:

  • Associate expression levels with patient survival, tumor stage, and treatment response

What cellular mechanisms link ZIP11 dysfunction to cancer progression?

Research on ZIP11 in HeLa cells has revealed several mechanisms connecting ZIP11 function to cancer progression:

• Cell proliferation regulation:

  • ZIP11 knockdown significantly impairs proliferation, inducing a senescent state

  • This phenotype can be rescued by reintroducing wild-type ZIP11 or specific mutants (A26S, A89V, A234P, P243S)

  • Metal binding site mutants (H204A, E208A) fail to rescue proliferation, suggesting zinc transport is essential for this function

• Nuclear zinc homeostasis:

  • ZIP11 knockdown leads to nuclear zinc accumulation

  • Cancer-associated mutations affect ZIP11's ability to maintain proper nuclear zinc levels

  • The A26S, A234P, and P243S mutations restore normal nuclear zinc, while A89V maintains elevated nuclear zinc

• Cell migration and invasion:

  • ZIP11 is required for normal migration and invasion of cancer cells

  • Different mutations have varying effects on rescuing migration and invasion capacity

  • The location of mutations relative to the substrate-binding region correlates with their impact on cancer-related phenotypes

To investigate these mechanisms:

• Perform cell cycle analysis using flow cytometry

• Measure senescence markers (β-galactosidase activity, p21, p53)

• Combine zinc imaging with cell cycle progression analysis

• Use zinc chelators or supplementation to test causality

How can I design experiments to investigate the functional consequences of ZIP11 mutations identified in cancer patients?

Based on successful approaches used in previous research :

• Generate cellular models expressing specific mutations:

  • Create stable cell lines with ZIP11 knockdown (target 3' UTR)

  • Rescue with wild-type or mutant ZIP11 (A26S, A89V, A234P, P243S)

  • Use lentiviral vectors for consistent expression levels

• Comprehensive phenotypic characterization:

  • Proliferation assays (growth curves, colony formation)

  • Migration assays (wound healing, transwell)

  • Invasion assays (Matrigel-coated transwell)

  • 3D spheroid formation and growth

• Zinc homeostasis analysis:

  • Subcellular fractionation followed by AAS for compartment-specific zinc quantification

  • Live cell imaging with zinc-specific fluorescent probes

  • Zinc dose-response studies to assess sensitivity thresholds

• Molecular pathway analysis:

  • RNA-seq to identify differentially expressed genes

  • Phospho-proteomic analysis to detect altered signaling pathways

  • Co-immunoprecipitation to identify protein interaction partners

  • ChIP-seq to assess zinc-dependent transcription factor binding

• Validation in patient-derived samples:

  • Correlate ZIP11 mutation status with zinc distribution in tumor samples

  • Analyze expression of zinc-dependent proteins in mutation-positive vs negative tumors

What are the considerations for using recombinant ZIP11 in blocking experiments with antibodies?

When designing blocking experiments with recombinant ZIP11 and corresponding antibodies:

• Optimal protein-to-antibody ratio: For the recombinant human ZIP11 (aa 222-264) control fragment, a 100x molar excess of the protein fragment relative to antibody concentration is recommended. This calculation should be based on both the concentration and molecular weight of the reagents .

• Incubation conditions: Pre-incubate the antibody-protein control fragment mixture for 30 minutes at room temperature before application to experimental samples .

• Controls to include:

  • Antibody alone without blocking peptide

  • Irrelevant peptide of similar size and charge

  • Concentration gradient of blocking peptide to demonstrate dose-dependence

  • Multiple antibodies targeting different epitopes to confirm specificity

• Application-specific considerations:

  • For immunohistochemistry/immunocytochemistry (IHC/ICC): Ensure complete blocking to prevent false-positive signals

  • For Western blotting (WB): Pre-block membrane for optimal results

  • For functional assays: Consider that blocking might not inhibit all functions of the protein

How can homology modeling inform our understanding of ZIP11 structure and guide experimental design?

Homology modeling has provided valuable insights into ZIP11 structure by comparing it with related transporters:

• Current structural models:

  • Alignment between human ZIP11 and BbZIP4 from B. bronchiseptica has identified conserved residues in the transport pathway

  • H204 in human ZIP11 corresponds to H177 in BbZIP4

  • E208 and E244 align with metal-binding residues E181 and E211 in BbZIP4

• Experimental applications of homology models:

  • Design mutations to test specific structural hypotheses

  • Predict substrate binding sites and transport mechanisms

  • Identify potential regulatory domains

  • Guide the design of inhibitors or activators

• Integration with experimental data:

  • Use site-directed mutagenesis to validate predictions

  • Compare predictions with experimental data on subcellular localization

  • Validate transport properties of mutants designed based on model predictions

  • Refine models based on experimental outcomes

• Advanced computational approaches:

  • Molecular dynamics simulations to analyze conformational changes

  • Docking studies with zinc and potential inhibitors

  • Electrostatic analysis to understand ion selectivity

The critical insight from modeling has been understanding how mutations in different regions affect function - mutations near the core (A234P, P243S) have stronger effects than those in peripheral regions (A26S, A89V) .

What experimental approaches can reveal the interaction between ZIP11 and other components of cellular zinc homeostasis?

To comprehensively map ZIP11's role in the zinc homeostasis network:

• Interactome analysis:

  • Immunoprecipitation followed by mass spectrometry

  • Proximity labeling approaches (BioID, APEX)

  • Yeast two-hybrid or mammalian two-hybrid screens

  • Split-protein complementation assays

• Functional relationships with other zinc transporters:

  • Generate combinatorial knockdown/knockout models of multiple transporters

  • Perform epistasis analysis to determine hierarchical relationships

  • Use zinc-responsive reporters to measure compensatory responses

• Transcriptional networks:

  • Analyze metal-responsive element activation

  • Chromatin immunoprecipitation to identify transcription factors binding to ZIP11 promoter

  • Determine how zinc status affects ZIP11 expression via metal-responsive transcription factors

• Post-translational regulation:

  • Identify regulatory modifications (phosphorylation, ubiquitination)

  • Analyze protein stability and turnover rates under varying zinc conditions

  • Characterize subcellular trafficking in response to zinc availability

• Integration with zinc-dependent proteome:

  • Analyze changes in zinc-finger proteins and metalloenzymes

  • Perform zinc proteomics to identify proteins affected by ZIP11 manipulation

  • Investigate consequences for zinc-dependent signaling pathways