Recombinant Bovine Zinc transporter ZIP4 (SLC39A4)

Shipped with Ice Packs
In Stock

Description

Molecular Overview of Recombinant Bovine ZIP4

Recombinant bovine ZIP4 is a synthetically produced version of the solute carrier family 39 member 4 (SLC39A4) protein, optimized for experimental studies. Key features include:

  • Structure: Contains eight transmembrane domains with an N-terminal extracellular ectodomain critical for zinc binding and a cytosolic C-terminal region involved in post-translational regulation .

  • Function: Mediates zinc influx across cell membranes, maintaining cellular zinc homeostasis .

  • Expression Systems: Produced in E. coli, yeast, baculovirus, or mammalian cell systems, with purity ≥85% as verified by SDS-PAGE .

Table 1: Key Properties of Recombinant Bovine ZIP4

PropertyDetail
Host SystemCell-free expression, E. coli, yeast, or mammalian cells
Purity≥85% (SDS-PAGE)
Molecular Weight~37 kDa (processed form lacking ectodomain)
ApplicationsZinc transport assays, structural studies, antibody production
  • Zinc Sensitivity: The ectodomain is proteolytically cleaved during zinc deficiency, generating a processed ~37 kDa fragment that accumulates on plasma membranes .

  • Regulation: Degraded via proteasomal/lysosomal pathways under zinc-replete conditions .

(A) Mechanistic Insights into Zinc Transport

  • Processed ZIP4 (lacking the ectodomain) retains zinc transport activity, as shown by hypersensitivity of Mt1 gene induction in transfected cells .

  • Mutations near the ectodomain cleavage site (e.g., acrodermatitis enteropathica variants) impair zinc uptake, highlighting the domain’s role in sensing zinc availability .

(B) Disease Modeling

  • Overexpression of ZIP4 in pancreatic cancer cells correlates with tumor progression, suggesting a role in oncogenesis .

  • Recombinant bovine ZIP4 enables cross-species studies of zinc deficiency disorders, such as acrodermatitis enteropathica .

(C) Therapeutic Development

  • ELISA kits for bovine ZIP4 (detection range: serum/plasma samples) facilitate biomarker research in zinc-related pathologies .

Table 2: ZIP4 Orthologs and Recombinant Forms

SpeciesRecombinant HostKey Findings
BovineCell-free expressionProcessed form dominates during zinc deficiency
HumanHEK293, MDCK cellsEctodomain cleavage blocked by disease mutations; hypersensitive to zinc
MouseHepa cellsZIP4 essential for embryogenesis; heterozygous mice show zinc sensitivity

Future Directions

  • Structural Studies: Resolve the cleavage site of the ectodomain to design inhibitors for cancer therapy .

  • Agricultural Research: Explore ZIP4’s role in bovine zinc metabolism to improve livestock health .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them when placing your order. We will accommodate your request as possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol final concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize its inclusion in the production process.
Synonyms
SLC39A4; ZIP4; Zinc transporter ZIP4; Solute carrier family 39 member 4; Zrt- and Irt-like protein 4; ZIP-4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
27-653
Protein Length
Full Length of Mature Protein
Species
Bos taurus (Bovine)
Target Names
SLC39A4
Target Protein Sequence
RPVHLLTLLSSGQGALDRVALGGLLNTLAARVHCADGPCGKCLSVDDALALGRPEQPGAP SGQVLEPRHIARLSAAAALYLSDPAGTCAEVRAGRWAARADQLLVLLESSQALSVALTRL LQQIQARAAGQPTSQQACVDLPQLLGEAAGIGAPGSPGPVLAALLGHVWSGACFHALPTP QYFVDFVFRQHSSENPNITLDELAALMERLGLGGATEPHDSHSDDSPLGKGQGPVPLAAP NSSASAWDTLCLSAQDIMAVYGMSEQAGVTPDDWARLSPALLQQQLSGACSPQPTLPTQD QLSQAERYLYGSLATLLICLCSLLGLLLLSCASCSTTSHYIIQAFLSMAVGALTGDALLH LMPKVLGLHTHDGEDHGFQPTWHLLAVLGGLYAFFLFERLFNLLLPLDPEDPKDGACSHG HSHGGHSHGVSLQLAPSDFRQPKQLHEGSRADLVAEESPELLSPEPRRRSPGLRLLPYVI TLGDAVHNFADGLAVGAAFLSSWKTGLATSLAVFCHEVPHELGDFAALLHAGLSVRRALL LNVASALTAFIGLYVALAAGVGEDGETWILAVAAGLFLYVALCDMLPAMLNVRDRRPWLL FLLHNVGLLGGWTVLLLLSLYEDNIAF
Uniprot No.

Target Background

Function
Recombinant Bovine Zinc transporter ZIP4 (SLC39A4) plays a crucial role in cellular zinc homeostasis as a zinc transporter. It is regulated in response to zinc availability.
Database Links
Involvement In Disease
Defects in SLC39A4 are the cause of bovine hereditary zinc-deficiency (BHZD); also known as lethal trait A46, Adema disease, hereditary parakeratosis, and hereditary thymus hypoplasia. BHZD is a autosomal recessive disease caused by the inability to absorb sufficient zinc. The symptoms are diarrhea, immune system dysfunction, skin lesions and death if untreated. Oral zinc supplementation allows symptom free development of calves (PubMed:16714095).
Protein Families
ZIP transporter (TC 2.A.5) family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Recycling endosome membrane; Multi-pass membrane protein.

Q&A

How does bovine ZIP4 regulate cellular zinc uptake at the molecular level?

Bovine ZIP4, similar to human ZIP4, functions as both a zinc transporter and sensor (transceptor). Research indicates that ZIP4 itself acts as the exclusive zinc sensor during zinc-dependent regulation . The transport site within the transmembrane domain is responsible for zinc sensing, which triggers conformational changes in the protein structure .

When examining zinc regulation mechanisms, researchers should note that:

  • The transport site in the transmembrane domain is structurally coupled with the second cytosolic loop (L2)

  • Zinc binding at the transport site induces conformational changes that can lead to endocytosis

  • In humans, a conserved Leu-Gln-Leu (LQL) motif in L2 is essential for constitutive endocytosis

For experimental design, researchers should consider that zinc-dependent endocytosis serves as a regulatory mechanism to control cellular zinc influx, representing an important post-translational regulation pathway for this nutrient transporter .

What are the optimal expression systems for producing recombinant bovine ZIP4 protein?

For recombinant expression of bovine ZIP4, researchers typically choose between mammalian, insect, or yeast expression systems. Each system offers distinct advantages:

Mammalian cell expression systems (such as HEK293 or CHO cells) provide the closest post-translational modification environment to native bovine cells. Studies on human ZIP4 have successfully utilized human cell lines for expression and functional studies . When expressing bovine ZIP4, consider:

  • Codon optimization for mammalian expression

  • Inclusion of appropriate tags (His, FLAG, etc.) for purification and detection

  • Use of inducible promoters to control expression levels

Insect cell systems offer good compromise between proper protein folding and higher yield. For membrane proteins like ZIP4, baculovirus-infected Sf9 or Hi5 cells often produce functional protein with correct topology.

When selecting an expression system, researchers should evaluate tradeoffs between protein yield, functional activity, and post-translational modifications based on their specific experimental requirements.

What methodologies are most effective for studying zinc-dependent endocytosis of bovine ZIP4?

Based on successful approaches with human ZIP4, the following methodologies are recommended for bovine ZIP4 studies:

  • Internalization assays: Utilize fluorescently-labeled antibodies against extracellular epitopes of ZIP4 or surface biotinylation techniques to track protein internalization rates in response to varying zinc concentrations .

  • Structure-guided mutagenesis: Identify conserved motifs through sequence alignment with human ZIP4, then perform site-directed mutagenesis to evaluate their functional importance. For human ZIP4, mutagenesis of the LQL motif and histidine residues has provided valuable insights into endocytosis mechanisms .

  • Partial proteolysis experiments: This approach can demonstrate structural coupling between the transport site and cytosolic loops upon zinc binding, revealing conformational changes that drive endocytosis .

  • Confocal microscopy: For visualizing ZIP4 trafficking using fluorescent tags or antibodies against the protein.

When designing these experiments, consider appropriate controls including zinc chelators (like TPEN) and ZIP4 mutants with impaired zinc transport capabilities.

How do mutations in bovine SLC39A4 affect protein function and zinc homeostasis?

While specific bovine SLC39A4 mutations are less documented than human variants, research approaches can be informed by human studies. In humans, mutations in SLC39A4 can lead to Acrodermatitis enteropathica (AE), a disorder characterized by zinc deficiency symptoms .

Two types of mutations particularly impact ZIP4 function:

  • Missense mutations: For example, the c.926G>T mutation in human SLC39A4 exon 5 leads to a substitution of the 309th amino acid residue cysteine with phenylalanine (p.Cys309Phe), potentially affecting protein structure and function . The following table illustrates predictive analysis of this mutation:

GeneMutationProtein ChangeSIFT ScorePolyPhen ScorePredicted Impact
SLC39A4c.926G>Tp.Cys309Phe0.0060.767Possibly damaging
  • Splice site mutations: Mutations at intron-exon boundaries (e.g., c.976+2T>A in human SLC39A4) can alter mRNA splicing, potentially resulting in truncated or non-functional proteins .

When analyzing bovine ZIP4 variants, researchers should employ both in silico prediction tools (SIFT, PolyPhen) and functional assays to determine the impact on:

  • Protein expression levels and subcellular localization

  • Zinc transport efficiency

  • Endocytosis rates in response to zinc

  • Protein-protein interactions

What evolutionary variations exist in bovine ZIP4 compared to other species, and how might these impact functional studies?

Evolutionary analysis of ZIP4 across species reveals interesting variations that may affect zinc homeostasis mechanisms. Human population studies have identified an amino acid replacement in ZIP4 that shows strong differentiation among populations, suggesting possible adaptive advantages .

When studying bovine ZIP4 evolution:

  • Examine selection signatures in bovine SLC39A4 sequences across different cattle breeds and related species

  • Consider how variations might reflect adaptation to different dietary zinc availabilities

  • Compare zinc binding residues conservation across species

Research indicates that reduced zinc uptake by certain ZIP4 variants may provide selective advantages in specific environments, possibly by limiting pathogen access to zinc . This evolutionary context is crucial when interpreting functional differences between bovine ZIP4 and its orthologs in other species.

How is bovine ZIP4 dysregulation implicated in cattle diseases, and what research approaches best characterize these pathologies?

While specific bovine ZIP4-related pathologies are less extensively documented than human conditions, researchers can draw parallels from human studies while investigating cattle diseases. In humans, ZIP4 mutations cause Acrodermatitis enteropathica (AE), characterized by dermatitis, alopecia, and diarrhea . For bovine research, key approaches include:

  • Clinical phenotyping: Systematically document zinc deficiency symptoms in cattle, including:

    • Skin lesions, particularly in periorificial regions

    • Growth retardation

    • Immune dysfunction

    • Reproductive abnormalities

  • Genotype-phenotype correlation studies: When investigating suspected bovine ZIP4 disorders, sequence the SLC39A4 gene from affected animals and compare with healthy controls to identify potentially pathogenic variants.

  • Functional validation: Express identified bovine ZIP4 variants in cell models to assess:

    • Protein localization (using immunofluorescence)

    • Zinc transport capability (using radioactive zinc uptake assays or zinc-sensitive fluorophores)

    • Protein stability and turnover rates

When analyzing clinical data, consider that ZIP4 dysfunction may present differently across species due to variations in zinc requirements and compensatory mechanisms.

What is the role of bovine ZIP4 in cancer biology, and how can this inform comparative oncology research?

  • Expression analysis: Examine ZIP4 expression levels in bovine tumor samples compared to normal tissues, with particular attention to:

    • Correlation with tumor progression markers

    • Association with metastatic potential

    • Prognostic value in veterinary oncology

  • Mechanistic studies: Investigate whether bovine ZIP4, like human ZIP4, influences:

    • Epithelial-mesenchymal transition (EMT) processes

    • Cancer cell migration and invasion

    • Resistance to apoptosis and chemotherapeutic agents

    • Cancer stem cell properties

  • Intervention approaches: Explore whether SLC39A4 silencing by lentivirus-mediated shRNA could block bovine cancer cell EMT and metastasis, similar to findings in human cancer models .

When designing these studies, researchers should consider species-specific differences in cancer biology while leveraging the comparative aspects to inform both veterinary and human oncology.

How does the transport site of bovine ZIP4 couple structurally with cytosolic domains during zinc sensing?

The structural coupling between transmembrane domains and cytosolic regions represents a sophisticated mechanism for zinc sensing and subsequent regulatory responses. Based on human ZIP4 studies, researchers investigating bovine ZIP4 should focus on:

  • Conformational changes: Zinc binding at the transport site induces structural rearrangements that propagate to cytosolic domains, particularly the second cytosolic loop (L2) . For bovine ZIP4, researchers should:

    • Map conserved residues in the transport pathway

    • Identify potential zinc coordination sites

    • Examine structural elements that might participate in allosteric communication

  • Experimental approaches: To characterize these conformational changes in bovine ZIP4:

    • Employ partial proteolysis experiments to detect structural alterations upon zinc binding

    • Use cysteine accessibility assays to probe dynamic changes in protein topology

    • Consider single-molecule FRET studies to measure distance changes between domains

  • Computational methods: Molecular dynamics simulations can provide insights into:

    • Zinc ion movement through the transport pathway

    • Conformational coupling between domains

    • Energy landscapes of structural transitions

The working model suggests that zinc binding at the transport site triggers conformational changes that allow cytosolic motifs (such as LQL in human ZIP4) to interact with endocytic machinery . This represents a sophisticated mechanism for post-translational regulation of zinc transport activity.

What are the contradictions in current understanding of zinc-binding domains in bovine ZIP4, and how might these be resolved?

Current research on ZIP4 presents several contradictions regarding the roles of different zinc-binding domains. In human ZIP4, two histidine-rich regions have been identified: one in the extracellular domain (ECD) and another in the second cytosolic loop (L2) . Interestingly:

  • Extracellular histidine-rich domain: Despite binding zinc with low micromolar affinity and playing a role in zinc transport, mutations of all four histidine residues (H238, H241, H243, and H245) in this region did not affect zinc sensing or endocytosis in human ZIP4 .

  • Cytosolic histidine-rich segment: Similarly, replacing all five histidine residues (H438, H441, H443, H446, and H448) with glycine residues in the L2 did not affect zinc-induced endocytosis, despite this region binding zinc with nanomolar affinity .

These contradictions suggest complex and possibly redundant mechanisms in zinc sensing and regulation. To resolve these inconsistencies in bovine ZIP4 research:

  • Perform systematic mutagenesis of zinc-binding residues in different domains simultaneously

  • Develop more sensitive assays to detect subtle functional differences

  • Consider potential species-specific differences in zinc regulation mechanisms

  • Investigate possible compensatory mechanisms that might mask phenotypes in single-domain mutations

Advanced structural biology approaches, including cryo-EM studies of bovine ZIP4 in different conformational states, could provide crucial insights into these mechanistic questions.

What advanced imaging techniques are most suitable for visualizing bovine ZIP4 trafficking in cellular models?

For studying bovine ZIP4 trafficking dynamics, researchers should consider these advanced imaging approaches:

  • Live-cell confocal microscopy: Utilizing ZIP4 fusion constructs with fluorescent proteins (e.g., GFP, mCherry) allows real-time tracking of protein movement. Consider:

    • Photoactivatable or photoconvertible fluorescent proteins to track specific protein populations

    • Dual-color imaging to simultaneously visualize ZIP4 and endocytic markers

    • Spinning disk confocal systems for reduced phototoxicity during long-term imaging

  • Super-resolution microscopy: Techniques like STORM, PALM, or STED provide nanoscale resolution that can reveal:

    • ZIP4 clustering behavior at the plasma membrane

    • Co-localization with endocytic machinery components

    • Distinct trafficking routes in response to different zinc concentrations

  • Correlative light and electron microscopy (CLEM): This approach bridges the resolution gap between fluorescence and electron microscopy, allowing researchers to:

    • Precisely localize ZIP4 within cellular ultrastructure

    • Visualize morphological changes associated with zinc-induced endocytosis

    • Identify specialized membrane domains involved in ZIP4 trafficking

  • Multi-angle total internal reflection fluorescence (TIRF) microscopy: Particularly valuable for studying early events in ZIP4 endocytosis at the plasma membrane with minimal background fluorescence.

When designing imaging experiments, researchers should consider potential artifacts from protein tagging and overexpression, validating results with complementary approaches such as immunofluorescence of endogenous protein when possible.

How can CRISPR-Cas9 gene editing be optimized for studying bovine ZIP4 function in cellular and animal models?

CRISPR-Cas9 technology offers powerful approaches for studying bovine ZIP4 function through precise genetic manipulation. Key considerations include:

  • Guide RNA design for bovine SLC39A4:

    • Target highly conserved functional domains identified through comparative analysis

    • Use bovine-specific genome databases to identify unique PAM sites

    • Employ multiple guide RNAs to increase editing efficiency

    • Consider potential off-target effects through comprehensive in silico prediction

  • Knock-in strategies for introducing specific mutations or tags:

    • Homology-directed repair (HDR) templates should include bovine-specific homology arms

    • For inserting fluorescent tags, consider flexible linker sequences to minimize functional disruption

    • When introducing point mutations based on human disease variants, verify conservation of the target residue

  • Validation approaches for confirming editing outcomes:

    • Genomic sequencing to verify intended modifications

    • Western blotting and immunofluorescence to assess protein expression and localization

    • Functional assays measuring zinc transport capacity using zinc-sensitive fluorophores

    • RNA-seq to identify potential compensatory mechanisms activated after ZIP4 modification

  • Advanced applications:

    • Base editing for introducing specific point mutations without double-strand breaks

    • Prime editing for precise insertions or deletions

    • Inducible CRISPR systems for temporal control of ZIP4 disruption

When transitioning from cellular to animal models, consider delivery methods appropriate for bovine systems, regulatory considerations, and ethical frameworks for gene editing in agricultural species.

How do zinc homeostasis mechanisms differ between bovine and human systems, and what implications does this have for translational research?

Comparative analysis of zinc homeostasis between bovine and human systems reveals important similarities and differences that impact translational research:

  • Physiological zinc requirements: Cattle typically have higher zinc requirements than humans relative to body weight, reflecting differences in:

    • Rumen microbial population zinc demands

    • Milk production requirements in dairy cattle

    • Different dietary zinc sources and bioavailability

  • Zinc transporter expression patterns: While the SLC39A4 gene shows conservation across species, expression patterns and regulation may differ significantly:

    • Human population studies have identified an amino acid replacement in ZIP4 that shows strong differentiation among populations, suggesting possible adaptive advantages

    • Similar evolutionary adaptations may exist in different cattle breeds adapted to varying geographical regions and diets

  • Research implications:

    • When extrapolating findings between species, account for differences in gastrointestinal physiology and zinc absorption kinetics

    • Consider potential differences in ZIP4 regulation under various physiological and pathological conditions

    • Validate key molecular mechanisms in species-appropriate models

The finding that reduced zinc uptake by certain human ZIP4 variants may starve pathogens of zinc suggests interesting possibilities for investigating similar mechanisms in bovine infectious disease resistance.

What insights from human ZIP4 mutational studies can inform research on bovine ZIP4 variation across different cattle breeds?

Human ZIP4 mutational studies provide valuable frameworks for investigating bovine ZIP4 variation:

  • Disease-causing mutations: In humans, over 30 different SLC39A4 mutations have been identified in Acrodermatitis enteropathica patients, affecting different functional domains . For bovine research:

    • Catalog SLC39A4 variations across cattle breeds

    • Focus particularly on breeds with known differences in zinc metabolism or susceptibility to zinc-deficiency conditions

    • Correlate genotypic variations with phenotypic differences in zinc utilization efficiency

  • Population adaptations: Human studies have identified ZIP4 variants with functional differences that may have provided selective advantages in certain geographical regions . Similarly in cattle:

    • Investigate whether breeds from different geographical origins show adaptive variations in ZIP4

    • Consider how domestication and selective breeding may have influenced ZIP4 evolution

    • Examine potential correlations between ZIP4 variants and resistance to specific pathogens

  • Methodological approaches:

    • Whole-genome sequencing of diverse cattle breeds to identify SLC39A4 variants

    • Functional characterization of identified variants using zinc transport assays

    • Population genetics analysis to identify signatures of selection

A comprehensive understanding of bovine ZIP4 variation would not only advance basic research but could also inform breeding programs aimed at optimizing zinc utilization and disease resistance in cattle.

What emerging technologies hold the most promise for elucidating the complete structure-function relationship of bovine ZIP4?

Several cutting-edge technologies are poised to revolutionize our understanding of bovine ZIP4 structure-function relationships:

  • Cryo-electron microscopy (cryo-EM): This technique has transformed structural biology of membrane proteins and offers particular advantages for ZIP4:

    • Ability to capture different conformational states during the transport cycle

    • Visualization of zinc binding sites at near-atomic resolution

    • Potential to resolve structures of ZIP4 in complex with regulatory partners

  • AlphaFold2 and other AI-based structure prediction: These computational approaches can:

    • Generate high-confidence models of bovine ZIP4 structure

    • Predict conformational changes associated with zinc binding

    • Guide experimental design for site-directed mutagenesis

  • Single-molecule techniques:

    • FRET-based approaches to measure real-time conformational dynamics

    • Force spectroscopy to characterize mechanical properties during transport

    • Single-molecule tracking in living cells to reveal population heterogeneity

  • Multi-omics integration:

    • Combining structural data with genomics, transcriptomics, and proteomics

    • Network analysis to place ZIP4 within the broader zinc homeostasis system

    • Systems biology approaches to model zinc transport kinetics

The integration of these technologies promises to provide unprecedented insights into how bovine ZIP4 structure determines its function in zinc transport and sensing.

How might understanding bovine ZIP4's dual role as transporter and zinc sensor inform therapeutic approaches for zinc-related disorders?

The dual functionality of ZIP4 as both transporter and sensor (transceptor) presents unique opportunities for therapeutic intervention in zinc-related disorders:

  • Targeted drug design:

    • Develop compounds that specifically modulate ZIP4's sensing function without affecting transport

    • Design allosteric modulators that stabilize specific conformational states

    • Create peptides that mimic the LQL motif to selectively interfere with endocytosis

  • Gene therapy approaches:

    • Use precise gene editing to correct pathogenic mutations while preserving regulatory functions

    • Develop tissue-specific expression systems for ZIP4 to address localized zinc deficiencies

    • Consider compensatory approaches targeting other zinc transporters when ZIP4 function is compromised

  • Nutritional interventions:

    • Design zinc supplementation strategies that account for ZIP4's dual functionality

    • Develop bioavailable zinc formulations that optimize absorption through functional ZIP4

    • Consider how dietary factors influence ZIP4 expression and activity

  • Therapeutic applications in cancer:

    • Target ZIP4 to reduce zinc availability to cancer cells, potentially increasing chemotherapy sensitivity

    • Develop selective inhibitors of ZIP4-mediated signaling that drives cancer progression

    • Explore ZIP4 as a biomarker for cancer prognosis and treatment response

Understanding the molecular mechanisms of ZIP4's dual functionality will be critical for developing these targeted therapeutic approaches in both human and veterinary medicine.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.