F1F0 ATP synthase synthesizes ATP from ADP using a proton or sodium gradient. This enzyme comprises two domains: the F1 domain, containing the extramembrane catalytic core, and the F0 domain, containing the membrane proton channel. These domains are linked by a central and peripheral stalk. ATP synthesis in the F1 catalytic domain is coupled, via a rotary mechanism of the central stalk subunits, to proton translocation. This protein is a component of the F0 channel, forming part of the peripheral stalk and linking F1 to F0.
KEGG: bdi:6439854
STRING: 15368.BRADI5G08883.1
What is Brachypodium distachyon ATP synthase subunit b, chloroplastic (atpF) and what is its significance in research?
Brachypodium distachyon ATP synthase subunit b, chloroplastic (atpF) is a 183-amino acid protein component of the ATP synthase F0 sector located in chloroplasts. This protein (UniProt ID: B3TN47) plays a crucial role in energy transduction during photosynthesis by contributing to the formation of the peripheral stalk of the ATP synthase complex. The full amino acid sequence is: MKNVTHSFVFLAHWPSAGSFGLNTDILATNLINLTVVVGVLIFFGKGVLKDLLDNRKQRILSTIRNSEELRRGTFEQLEKARIRLQKVELEADEYRMNGYSEIEREKENLINATSISLEQLEKSKNETLYFEKQRAMNQVRQRVFQQAVQGALGTLNSCLNTELHFRTIRANIGILGSMEWKR . Its significance in research stems from its central role in photosynthetic energy production, making it relevant for studies on plant bioenergetics, chloroplast function, and potential biotechnological applications in crop improvement.
How is recombinant Brachypodium distachyon atpF protein produced and purified for research applications?
The production of recombinant atpF protein follows a systematic methodology that includes:
Gene cloning: The atpF coding sequence (1-183 amino acids) is amplified or synthesized and inserted into an expression vector with an N-terminal His-tag .
Host selection: E. coli is typically used as the expression host due to its efficiency and scalability .
Protein expression: Transformed bacteria are cultured and protein expression is induced under optimized conditions.
Cell lysis and extraction: Bacterial cells are harvested and lysed to release the recombinant protein.
Affinity purification: His-tagged atpF protein is purified using nickel affinity chromatography.
Quality assessment: SDS-PAGE analysis confirms protein purity (typically >90%) .
Formulation: The purified protein is formulated in a Tris/PBS-based buffer with 6% trehalose at pH 8.0 .
Final preparation: The protein is typically provided as a lyophilized powder for improved stability .
What are the optimal storage and handling conditions for recombinant atpF protein?
Preserving the structural integrity and biological activity of recombinant atpF requires specific storage and handling protocols:
Long-term storage: Store lyophilized protein at -20°C to -80°C for extended stability .
Reconstitution protocol: Before opening, briefly centrifuge the vial to bring contents to the bottom. Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL .
Aliquoting strategy: Following reconstitution, add glycerol to a final concentration of 5-50% (optimal: 50%) and create single-use aliquots to avoid repeated freeze-thaw cycles .
Working storage: Working aliquots can be stored at 4°C for up to one week .
Stability considerations: Repeated freeze-thaw cycles significantly reduce protein activity and should be strictly avoided .
These protocols ensure maximum retention of structural and functional integrity throughout experimental workflows.
How does atpF protein structure relate to its function in the ATP synthase complex?
The atpF protein structure exhibits specialized domains that directly correlate with its function:
N-terminal domain: Contains a chloroplast transit peptide that directs the protein to its subcellular location.
Transmembrane domain (approximately residues 26-48): Forms an alpha-helical structure that anchors the protein in the thylakoid membrane. The sequence VFLAHWPSAGSFGLNTDILATNLINLTVVVGVLIFFGK contains predominantly hydrophobic residues optimized for membrane integration .
Central stalk region: Contains the highly conserved LSTIRN motif essential for interactions with other ATP synthase subunits and the formation of the peripheral stalk.
C-terminal domain: Rich in charged and polar amino acids that facilitate interactions with the F1 sector of ATP synthase.
This structure-function relationship enables atpF to serve as both a structural component that stabilizes the ATP synthase complex and a functional element that contributes to the rotational mechanism driving ATP synthesis during photosynthesis.