Recombinant Brachypodium distachyon NAD (P)H-quinone oxidoreductase subunit 3, chloroplastic

Shipped with Ice Packs
In Stock
Cat. No.
BT2466722
Source
in vitro E.coli expression system
Synonyms
ndhC; NAD(PH-quinone oxidoreductase subunit 3, chloroplastic; NAD(PH dehydrogenase subunit 3; NADH-plastoquinone oxidoreductase subunit 3
Quick Inquiry

Description

Genetic and Proteomic Context

The ndhC gene encodes a transmembrane subunit of the chloroplast NDH complex, which is evolutionarily related to mitochondrial Complex I . In Brachypodium distachyon, knockdowns of related NDH subunits (e.g., ndhH) have been linked to disrupted redox homeostasis and increased reactive oxygen species (ROS) accumulation, emphasizing ndhC’s role in maintaining photosynthetic efficiency . Proteomic studies reveal that NDH subunits like ndhC are downregulated in plants with compromised lignin biosynthesis, suggesting interplay between redox balance and secondary metabolism .

Role in Redox Homeostasis

  • The NDH complex, including ndhC, participates in cyclic electron flow around Photosystem I, critical for ATP synthesis and ROS mitigation .

  • In Brachypodium mutants with suppressed lignin biosynthesis, NDH complex proteins are significantly downregulated, correlating with elevated DNA damage markers (e.g., histone H2AX) and impaired stress responses .

Biotechnological Utility

  • Recombinant ndhC is used to generate antibodies for immunoblotting and functional studies of chloroplast electron transport .

  • Its high-purity production in E. coli enables structural studies, such as resolving NDH-PSI supercomplex architectures in grasses .

Key Research Insights

  • Multi-omic Profiling: Proteomic analyses of Brachypodium mutants highlight ndhC’s association with redox-sensitive pathways, including ascorbate-glutathione cycling and DNA repair mechanisms .

  • Stress Adaptation: ndhC knockdowns exhibit reduced NAD(P)H dehydrogenase activity, impairing photoprotection under high-light stress .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: Tag type is determined during production. To specify a tag, please inform us, and we will prioritize its development.
Synonyms
ndhC; NAD(PH-quinone oxidoreductase subunit 3, chloroplastic; NAD(PH dehydrogenase subunit 3; NADH-plastoquinone oxidoreductase subunit 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-120
Protein Length
full length protein
Species
Brachypodium distachyon (Purple false brome) (Trachynia distachya)
Target Names
ndhC
Target Protein Sequence
MFLLHEYDIFWTFLIIASLIPILAFWISGLLAPISEGPEKLSSYESGIEPMGGAWLQFRI RYYMFALVFVVFDVETVFLYPWAMSFDVLGVSVFIEAFIFVLILVVGLVYAWRKGALEWS
Uniprot No.
B3TN56

Target Background

Function
NDH (NAD(P)H-quinone oxidoreductase) shuttles electrons from NAD(P)H:plastoquinone, utilizing FMN and iron-sulfur (Fe-S) centers, to quinones within the photosynthetic electron transport chain and potentially a chloroplast respiratory chain. In this species, plastoquinone is believed to be the immediate electron acceptor. The enzyme couples this redox reaction to proton translocation, thereby conserving redox energy as a proton gradient.
Database Links

KEGG: bdi:6439845

STRING: 15368.BRADI5G05680.1

Protein Families
Complex I subunit 3 family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *

Category

Service

THE BIOTEK
THE BioTek is a global biotech company offering highly purified proteins for research in cancer, apoptosis, development, endocrinology, immunology, neuroscience, proteases, and stem cells.
  • Contact
  • Address: 1925 E Maple Ave, El Segundo, CA 90245 United States
  • Phone : +1 201-285-7826
  • Email : info@thebiotek.com
  • Hours : Mon.-Fri. 9:00 AM - 5:00 PM
© Copyright 2025 TheBiotek. All Rights Reserved.