Recombinant Brachypodium distachyon NAD (P)H-quinone oxidoreductase subunit 4L, chloroplastic

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will accommodate your request whenever possible.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery estimates.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the protein's intrinsic stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize its development accordingly.
Synonyms
ndhE; NAD(PH-quinone oxidoreductase subunit 4L, chloroplastic; NAD(PH dehydrogenase subunit 4L; NADH-plastoquinone oxidoreductase subunit 4L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-101
Protein Length
full length protein
Species
Brachypodium distachyon (Purple false brome) (Trachynia distachya)
Target Names
ndhE
Target Protein Sequence
MMFEHVLFLSVYLFSIGIYGLITSRNMVRALICLELILNSINLNLVTFSDLFDSRQLKGD IFAIFVIALAAAEAAIGLSILSSIHRNRKSTRINQSNFLNN
Uniprot No.

Target Background

Function
NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. It couples the redox reaction to proton translocation, thus conserving the redox energy in a proton gradient.
Database Links

KEGG: bdi:6439824

Protein Families
Complex I subunit 4L family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the basic function of NAD(P)H-quinone oxidoreductase in chloroplasts?

NAD(P)H-quinone oxidoreductase in chloroplasts primarily catalyzes the two-electron reduction of quinones to hydroquinones using NADPH as a cofactor. This enzyme plays a crucial role in detoxifying reactive quinones that could otherwise participate in redox cycling and generate reactive oxygen species (ROS). The reduction process is particularly important as it converts potentially harmful quinones into more stable hydroquinone forms, preventing oxidative damage to chloroplast components. Additionally, this enzyme contributes to maintaining the redox balance within the chloroplast, which is essential for optimal photosynthetic function and stress response .

How does the chloroplastic localization of this protein affect its function compared to cytosolic NAD(P)H-quinone oxidoreductases?

The chloroplastic localization provides this oxidoreductase with distinct functional properties compared to its cytosolic counterparts. Unlike cytosolic versions, the chloroplastic NAD(P)H-quinone oxidoreductase operates in an environment with high photosynthetic activity where ROS generation is a constant challenge due to electron transport processes. This enzyme lacks a classical N-terminal cleavable chloroplast transit peptide and is transported through the chloroplast envelope membrane by an alternative pathway without cleavage of its internal chloroplast targeting sequence . This unique localization mechanism suggests specialized functions related to chloroplast redox homeostasis, potentially including protection of photosynthetic machinery from oxidative damage and participation in stress response pathways specific to plastids. The protein likely interacts with chloroplast-specific quinones and may be regulated by light-dependent mechanisms not present in cytosolic isoforms .

What are the key structural domains and catalytic residues in Brachypodium distachyon NAD(P)H-quinone oxidoreductase subunit 4L?

While specific structural information for the Brachypodium distachyon protein is limited in the provided search results, general structural features can be inferred from related quinone oxidoreductases. This enzyme likely contains a flavin-binding domain that accommodates FAD or FMN as a cofactor, which is essential for electron transfer during catalysis. The protein probably possesses an NADPH-binding domain characterized by a Rossmann fold structure. Critical catalytic residues typically include those involved in flavin binding (often involving hydrogen bonding with aromatic residues), NADPH binding (frequently containing a GxGxxG motif), and quinone substrate binding sites. The quaternary structure may involve assembly into functional complexes, as seen in other plant chloroplastic oxidoreductases. Crystallographic studies, such as those performed on related proteins like the ceQORH from Arabidopsis thaliana, have revealed that these enzymes often exist as dimers in solution, with two molecules in the asymmetric unit when crystallized .

What are the optimal conditions for expressing recombinant Brachypodium distachyon NAD(P)H-quinone oxidoreductase in bacterial systems?

For optimal expression of recombinant Brachypodium distachyon NAD(P)H-quinone oxidoreductase in bacterial systems, researchers should consider using E. coli BL21(DE3) strain, which provides efficient expression for plant proteins with minimal proteolytic degradation. Expression vectors containing strong inducible promoters like T7 or tac are recommended, with the addition of appropriate fusion tags (His, MBP, or GST) to facilitate purification and potentially enhance solubility. The expression protocol should include the following parameters: induction at OD600 of 0.6-0.8 with 0.1-0.5 mM IPTG, followed by expression at a reduced temperature (16-20°C) for 16-20 hours to enhance proper folding and solubility. Supplementation of the growth medium with riboflavin or FMN (5-10 μM) can improve flavin incorporation. For extraction, a buffer containing 50 mM Tris-HCl (pH 8.0), 300 mM NaCl, 10% glycerol, and 1 mM DTT is typically effective, with the addition of 0.5-1% Triton X-100 or mild detergents if membrane association is a concern .

What enzymatic assay methods are most reliable for measuring NAD(P)H-quinone oxidoreductase activity in chloroplastic preparations?

The most reliable enzymatic assay methods for measuring NAD(P)H-quinone oxidoreductase activity in chloroplastic preparations involve spectrophotometric monitoring of NADPH oxidation at 340 nm (ε = 6,220 M⁻¹cm⁻¹). A standard reaction mixture should contain 50 mM phosphate buffer (pH 7.4), 0.2 mM NADPH, appropriate quinone substrate (usually 50-100 μM), and the enzyme preparation. Activity is calculated by measuring the decrease in absorbance over time, with one unit of enzyme activity defined as the amount that catalyzes the oxidation of 1 μmol of NADPH per minute. Alternative approaches include HPLC analysis of quinone/hydroquinone substrate/product pairs or oxygen consumption measurements when investigating ROS-related functions. For increased specificity, researchers can employ inhibitors like dicoumarol to distinguish different quinone oxidoreductase activities. When working with chloroplastic preparations, it is essential to minimize light exposure during the assay to prevent photosynthetic electron transport interference and include proper controls for non-enzymatic quinone reduction. Additionally, using a range of physiologically relevant quinone substrates provides valuable insights into substrate specificity profiles .

How can researchers effectively purify the recombinant protein while maintaining its enzymatic activity?

To effectively purify recombinant Brachypodium distachyon NAD(P)H-quinone oxidoreductase while preserving enzymatic activity, researchers should implement a multi-step purification strategy. Initial capture can be performed using affinity chromatography (Ni-NTA for His-tagged proteins or amylose resin for MBP-fusion proteins) as demonstrated in pull-down assays with related proteins . Throughout the purification process, all buffers should contain 1-5 mM DTT or 2-mercaptoethanol to protect critical thiol groups, and 10% glycerol to stabilize the protein structure. The recommended buffer composition includes 50 mM Tris-HCl (pH 7.5-8.0) and 100-150 mM NaCl. For optimal results, perform all purification steps at 4°C and complete the process within 24-48 hours to minimize activity loss. Further purification can be achieved using ion-exchange chromatography (typically Q-Sepharose) followed by size-exclusion chromatography to obtain homogeneous preparations. During purification, activity assays should be conducted after each step to track recovery. The purified enzyme should be stored in small aliquots at -80°C in storage buffer containing 20% glycerol. Freeze-thaw cycles should be minimized as they significantly reduce enzymatic activity .

How does NAD(P)H-quinone oxidoreductase contribute to ROS management in chloroplasts during various stress conditions?

NAD(P)H-quinone oxidoreductase plays a multifaceted role in ROS management within chloroplasts during stress conditions. This enzyme efficiently catalyzes the two-electron reduction of quinones to hydroquinones, preventing the formation of semiquinone radicals that could otherwise participate in ROS-generating redox cycling. During oxidative stress, the expression of quinone oxidoreductases is typically induced, providing enhanced protection against ROS accumulation . This enzyme also contributes to maintaining the reduced state of endogenous antioxidants like α-tocopherol-hydroquinone and ubiquinol, which serve as important free radical scavengers in thylakoid membranes. Under high light conditions, photorespiratory stress, or drought, chloroplastic quinone oxidoreductase activity increases to counteract elevated ROS production from the photosynthetic electron transport chain. Additionally, studies in related systems suggest that this enzyme may participate in specialized redox signaling pathways that activate stress response mechanisms, thereby contributing to both direct detoxification and indirect regulatory functions in stress adaptation .

What evidence exists for the interaction between chloroplastic NAD(P)H-quinone oxidoreductase and other proteins in stress response pathways?

Current evidence suggests several important protein-protein interactions involving chloroplastic NAD(P)H-quinone oxidoreductase in stress response pathways. Though not specifically documented for the Brachypodium distachyon protein, related quinone oxidoreductases have been shown to interact with components of antioxidant defense systems and stress signaling networks. Research techniques including yeast two-hybrid (Y2H) and pull-down assays have demonstrated physical interactions between certain oxidoreductases and partner proteins, as exemplified by the OsMFS1/OsHOP2 complex in rice . In stress response contexts, NAD(P)H-quinone oxidoreductases may associate with thioredoxins, glutaredoxins, or peroxiredoxins to form functional redox networks. Additionally, there is evidence that these enzymes can interact with transcription factors like Nrf2 (or plant homologs) that regulate antioxidant response elements (AREs) . The protein may also associate with components of the chloroplast envelope translocon machinery through its unique targeting sequence, as suggested by studies on the Arabidopsis ceQORH protein . These interactions likely facilitate coordinated responses to oxidative stress and may explain how the enzyme contributes to multiple layers of cellular protection beyond its catalytic function .

What is known about the role of NAD(P)H-quinone oxidoreductase in plant immune responses and disease resistance?

Research indicates that NAD(P)H-quinone oxidoreductase contributes significantly to plant immune responses and disease resistance through multiple mechanisms. Studies with NQO1-deficient systems have revealed important immunomodulatory functions, including regulation of T helper 17 cells (Th17) differentiation and cytokine production . In plants specifically, chloroplastic quinone oxidoreductases appear to function at the intersection of redox homeostasis and immune signaling. The enzyme's ability to detoxify quinones may protect against oxidative bursts that occur during pathogen recognition, while simultaneously maintaining the redox state necessary for proper immune signal transduction. Elevated ROS levels in NQO1-deficient cells are associated with increased production of the immunosuppressive cytokine IL-10, suggesting that quinone oxidoreductases indirectly regulate immune response intensity through ROS management . Additionally, the enzyme likely participates in the metabolism of defensive quinones produced during pathogen attack. The relationship between quinone oxidoreductase activity and transcription factors involved in defense gene activation (like those regulated through AREs and XREs) further supports its role in coordinating redox status with immune response programs . These findings collectively indicate that chloroplastic NAD(P)H-quinone oxidoreductase serves as a key component in plant disease resistance pathways.

What are the current challenges in elucidating the three-dimensional structure of chloroplastic NAD(P)H-quinone oxidoreductase and how might they be overcome?

Determining the three-dimensional structure of chloroplastic NAD(P)H-quinone oxidoreductase presents several significant challenges. The protein's association with chloroplast membranes and its potential conformational flexibility during substrate binding and catalysis complicate crystallization efforts. Furthermore, the presence of cofactors and the potential for oligomerization add layers of complexity to structural studies. Based on analytical ultracentrifugation and preliminary X-ray studies of related proteins, researchers have determined that these enzymes often form dimers in solution and crystallize in specific space groups such as C2221 .

To overcome these challenges, researchers should consider:

Success will likely require integrating multiple structural biology approaches and iterative protein design, similar to the maquette approach described for other oxidoreductases .

How does the substrate specificity of Brachypodium distachyon NAD(P)H-quinone oxidoreductase compare with homologs from other plant species?

The substrate specificity of Brachypodium distachyon NAD(P)H-quinone oxidoreductase likely exhibits both conserved features and species-specific adaptations compared to homologs from other plants. While specific data for the Brachypodium enzyme is limited, comparative analysis with related proteins reveals potential patterns in quinone substrate preferences.

A comprehensive substrate specificity comparison would involve the following parameters:

Quinone SubstrateBrachypodium distachyonArabidopsis thalianaRice (Oryza sativa)Other Model Plants
BenzoquinonesLikely high activityHigh activityHigh activityGenerally preferred
NaphthoquinonesModerate activityVariable activityModerate activitySpecies-dependent
AnthraquinonesLower activityLower activityLower activityGenerally less preferred
PlastoquinoneHigh activity (chloroplast-specific)High activityHigh activityEssential substrate
UbiquinoneModerate activityModerate activityModerate activitySecondary substrate
PhylloquinoneSpecies-specificLow activityUnknownVariable activity

What experimental approaches are most promising for investigating the in vivo regulation of NAD(P)H-quinone oxidoreductase under different environmental stresses?

Multiple experimental approaches show promise for investigating the in vivo regulation of NAD(P)H-quinone oxidoreductase under environmental stresses. A comprehensive research strategy should integrate the following methodologies:

  • Transcriptional Regulation Studies:

    • RNA-seq analysis of stress-treated plants to identify transcriptional changes

    • Chromatin immunoprecipitation (ChIP) to identify transcription factors (like Nrf2 homologs) that bind to antioxidant response elements (AREs) and xenobiotic response elements (XREs) in the promoter region

    • Promoter-reporter constructs to monitor stress-responsive expression patterns in planta

  • Post-translational Modification Analysis:

    • Phosphoproteomics to identify stress-induced phosphorylation sites

    • Redox proteomics to detect modifications of critical cysteine residues under oxidative stress

    • Mass spectrometry-based approaches to identify other modifications (acetylation, ubiquitination)

  • Protein-Protein Interaction Mapping:

    • Co-immunoprecipitation followed by mass spectrometry to identify stress-specific interactors

    • Split-GFP or FRET-based assays to visualize dynamic interactions in living plant cells

    • Yeast two-hybrid and pull-down assays as demonstrated with related proteins

  • In Vivo Activity Monitoring:

    • Development of genetically encoded fluorescent sensors for NAD(P)H-quinone oxidoreductase activity

    • Real-time monitoring of ROS levels and quinone/hydroquinone ratios in chloroplasts during stress

    • Correlation of enzyme activity with physiological parameters under controlled stress conditions

  • Genetic Manipulation Approaches:

    • CRISPR/Cas9-mediated mutagenesis to generate variants with modified regulatory sites

    • Overexpression and knockdown lines to assess phenotypic consequences under stress

    • Complementation studies with site-specific mutants to validate regulatory mechanisms

This multifaceted approach would provide a comprehensive understanding of how environmental stresses modulate NAD(P)H-quinone oxidoreductase activity at multiple regulatory levels .

How has the function of NAD(P)H-quinone oxidoreductase evolved across plant species, particularly in relation to specialized metabolism?

The evolution of NAD(P)H-quinone oxidoreductase across plant species reveals fascinating adaptations related to specialized metabolism and environmental challenges. Phylogenetic analysis suggests that chloroplastic NAD(P)H-quinone oxidoreductases originated from ancestral oxidoreductases and subsequently diversified to fulfill specialized functions in different plant lineages. In grasses like Brachypodium distachyon, these enzymes likely evolved specific adaptations for metabolizing benzoxazinoid-derived quinones involved in defense against herbivores and pathogens. Monocots and dicots show divergent patterns of quinone oxidoreductase evolution, with differential expansion of gene families related to their distinct specialized metabolic pathways. The chloroplastic localization represents a key evolutionary innovation, allowing these enzymes to directly protect photosynthetic machinery from oxidative damage. Molecular clock analyses suggest that major diversification events in plant NAD(P)H-quinone oxidoreductases coincided with land plant radiation, indicating their importance in adaptation to terrestrial environments with increased oxidative stress. Comparative studies of enzyme kinetics across species reveal optimization for different quinone substrates, reflecting co-evolution with specialized metabolic pathways. Conservation patterns in catalytic domains versus substrate-binding regions highlight the balance between maintaining core functions while adapting to novel substrates produced through specialized metabolism .

What are the key differences between plant NAD(P)H-quinone oxidoreductases and their mammalian counterparts in terms of structure, regulation and function?

Plant NAD(P)H-quinone oxidoreductases and their mammalian counterparts exhibit several significant differences in structure, regulation, and function, reflecting their adaptation to different cellular environments and physiological roles. The following table summarizes key differences:

FeaturePlant NAD(P)H-quinone oxidoreductasesMammalian NQO1/NQO2
Subcellular localizationMultiple isoforms in chloroplasts, mitochondria, cytosolPrimarily cytosolic
Cofactor preferenceGreater variation in NADPH vs. NADH specificityNQO1: uses both NADH and NADPH; NQO2: uses dihydronicotinamide riboside
Regulatory elementsResponsive to AREs, XREs, and light-responsive elementsPrimarily regulated through ARE and XRE elements
Transcription factorsPlant-specific transcription factors and Nrf2 homologsNrf2 and AhR are primary regulators
Post-translational regulationLikely regulated by chloroplast redox status and photosynthetic activityRegulated by p53 interaction and proteasomal degradation
Physiological rolesProtection of photosynthetic apparatus, specialized metabolismXenobiotic detoxification, p53 stabilization
Protein structureChloroplastic forms have unique targeting sequences and transit peptidesLacks chloroplast targeting domains; has distinct C-terminal domain
Substrate specificityAdapted for plant-specific quinones (plastoquinone)Broader specificity for xenobiotic quinones
Interaction partnersInteracts with photosynthetic complexes and plant-specific antioxidant systemsInteracts with p53, 20S proteasome, and mammalian-specific proteins

These differences reflect the distinct evolutionary trajectories and physiological demands of plant and mammalian systems. The plant enzymes have evolved specialized roles in photosynthetic organisms, particularly in managing ROS generated during photosynthesis and metabolizing plant-specific secondary metabolites, while mammalian NQO1 has developed unique roles in cancer prevention through p53 stabilization .

How can engineered variants of NAD(P)H-quinone oxidoreductase be utilized in synthetic biology applications for enhanced stress tolerance?

Engineered variants of NAD(P)H-quinone oxidoreductase offer significant potential for synthetic biology applications aimed at enhancing stress tolerance in plants. The maquette protein design approach provides a valuable framework for creating customized oxidoreductases with specific properties for stress mitigation . Researchers can implement the following engineering strategies:

  • Enhanced Catalytic Efficiency:

    • Rational design of the active site to improve kcat/Km for specific quinone substrates

    • Directed evolution to select variants with superior ROS-scavenging capabilities

    • Introduction of mutations that enhance NADPH binding or reduce product inhibition

  • Modified Regulation:

    • Engineering constitutive expression by removing regulatory constraints

    • Creating stress-responsive variants through modification of redox-sensitive residues

    • Designing synthetic promoters with customized response elements for specific stress conditions

  • Altered Localization and Interaction Partners:

    • Targeting engineered variants to multiple subcellular compartments through fusion with different targeting sequences

    • Creating bifunctional enzymes by fusion with complementary antioxidant enzymes (e.g., superoxide dismutase)

    • Engineering new protein-protein interaction domains to create synthetic redox-regulatory networks

  • Application-Specific Modifications:

    • Drought tolerance: Variants optimized for functioning at low water potentials

    • Heat tolerance: Thermostable variants with maintained activity at elevated temperatures

    • Pathogen resistance: Variants capable of detoxifying pathogen-produced quinones

Implementation of these strategies would involve iterative protein design as described in the maquette approach, with each cycle incorporating experimental feedback to refine the engineered proteins . Progress in this area could lead to crops with significantly enhanced tolerance to multiple environmental stresses, contributing to agricultural sustainability under changing climate conditions. The four-α-helix bundle structure provides an excellent scaffold for these engineering efforts, allowing for systematic modification of functional properties while maintaining structural integrity .

What are the most common technical challenges in working with recombinant chloroplastic proteins, and how can they be addressed?

Working with recombinant chloroplastic proteins presents several technical challenges that require specific strategies to overcome. The most common difficulties and their solutions include:

  • Poor Solubility and Inclusion Body Formation:

    • Reduce expression temperature to 16-18°C and induce with lower IPTG concentrations (0.1-0.2 mM)

    • Use solubility-enhancing fusion partners such as MBP, SUMO, or Thioredoxin

    • Optimize lysis buffers with mild detergents (0.1% Triton X-100) and solubilizing agents (5-10% glycerol)

    • Develop refolding protocols from inclusion bodies using gradual dialysis against decreasing concentrations of chaotropic agents

  • Cofactor Incorporation Issues:

    • Supplement expression media with riboflavin or FMN (5-10 μM)

    • Add cofactors during protein purification (1-5 μM FAD or FMN in purification buffers)

    • Implement reconstitution protocols for apo-enzyme forms using excess cofactors followed by removal of unbound molecules

  • Protein Instability and Aggregation:

    • Include reducing agents (1-5 mM DTT or 2-mercaptoethanol) in all buffers

    • Add stabilizing agents like glycerol (10-20%) and specific substrates or substrate analogs

    • Determine and maintain optimal pH and ionic strength conditions

    • Store at -80°C in small aliquots to avoid repeated freeze-thaw cycles

  • Chloroplast Transit Peptide Processing:

    • Consider expressing mature forms without transit peptides

    • Test different constructs with various N-terminal truncations

    • Express with and without predicted targeting sequences to compare activity and solubility

  • Activity Loss During Purification:

    • Minimize purification steps and time

    • Maintain consistent low temperature (4°C) throughout the process

    • Include stabilizing ligands and cofactors in purification buffers

    • Test different immobilization strategies for affinity tags to minimize steric hindrance of active sites

These approaches have been successful with related oxidoreductases and should be applicable to the Brachypodium distachyon NAD(P)H-quinone oxidoreductase, given the similar technical challenges observed with other chloroplastic proteins .

How can researchers distinguish between specific NAD(P)H-quinone oxidoreductase activity and other oxidoreductase activities in complex biological samples?

Distinguishing specific NAD(P)H-quinone oxidoreductase activity from other oxidoreductases in complex biological samples requires a combination of selective inhibitors, substrate specificity analysis, and targeted approaches. Researchers should implement the following comprehensive strategy:

  • Selective Inhibitor Profiling:

    • Use dicoumarol (5-50 μM) as a specific inhibitor of NQO1-type quinone oxidoreductases

    • Apply flavonoids like quercetin to selectively inhibit certain quinone oxidoreductases

    • Incorporate cibacron blue as an inhibitor of NADPH-binding enzymes

    • Create inhibition profiles across multiple concentrations to distinguish between enzyme classes

  • Substrate Specificity Analysis:

    • Test activity with benzoquinones (specific for NAD(P)H-quinone oxidoreductases)

    • Compare activities with physiological substrates versus synthetic quinones

    • Analyze kinetic parameters (Km, Vmax) for different substrates to identify characteristic patterns

    • Use duroquinone as a diagnostic substrate for NQO1-type activities

  • Molecular and Immunological Approaches:

    • Employ immunodepletion with specific antibodies against the target enzyme

    • Perform activity staining following native PAGE to visualize specific bands

    • Use RNA interference or CRISPR knockout models to verify specific activities

    • Analyze activity in fractionated samples (e.g., chloroplasts versus cytosolic fractions)

  • Spectral and Analytical Methods:

    • Monitor characteristic spectral changes during catalysis (wavelength scans from 300-700 nm)

    • Utilize HPLC or LC-MS to identify specific quinone reduction products

    • Apply isotope-labeled substrates to track specific enzymatic conversions

    • Employ differential scanning fluorimetry with various substrates to assess binding specificity

By combining these approaches, researchers can confidently attribute measured activities to specific NAD(P)H-quinone oxidoreductases even in complex biological samples containing multiple oxidoreductases with overlapping functions .

What considerations are important when designing inhibition studies for NAD(P)H-quinone oxidoreductase, and how should the data be interpreted?

When designing inhibition studies for NAD(P)H-quinone oxidoreductase, researchers must carefully consider multiple factors to ensure valid and interpretable results. The following comprehensive framework addresses key considerations:

  • Inhibitor Selection and Characterization:

    • Choose inhibitors from different chemical classes (coumarins, flavonoids, quinones, metal ions)

    • Verify inhibitor purity and stability under assay conditions

    • Determine potential redox cycling or fluorescence properties that might interfere with assays

    • Establish solubility limits and use appropriate vehicles (DMSO typically ≤1%)

  • Assay Design Considerations:

    • Include proper vehicle controls at all inhibitor concentrations tested

    • Pre-incubate enzyme with inhibitors before initiating reactions to capture slow-binding effects

    • Vary substrate concentrations to distinguish competitive, non-competitive, and uncompetitive inhibition

    • Account for potential light sensitivity of certain inhibitors during assay design

  • Data Analysis Framework:

    • Determine IC50 values using at least 5-7 inhibitor concentrations spanning 100-fold range

    • Generate Dixon and Lineweaver-Burk plots to establish inhibition mechanisms

    • Calculate Ki values accurately by fitting to appropriate inhibition models

    • Apply global fitting approaches for complex inhibition patterns

  • Physiological Relevance Assessment:

    • Correlate in vitro inhibition constants with estimated cellular concentrations

    • Consider potential metabolic activation or deactivation of inhibitors

    • Evaluate inhibitor selectivity across related enzymes to assess specificity

    • Design cellular validation experiments to confirm mechanism of action

  • Data Interpretation Guidelines:

    • Interpret inhibition patterns in context of enzyme's structural features

    • Consider allosteric effects and potential binding to sites distinct from active center

    • Evaluate time-dependent changes in inhibition that might indicate mechanism-based inactivation

    • Account for potential redox effects that may indirectly affect enzyme activity

This structured approach ensures rigorous inhibition studies that provide meaningful insights into both the basic biochemistry of NAD(P)H-quinone oxidoreductase and potential applications in modulating its activity in biological systems .

What emerging technologies hold the most promise for advancing our understanding of chloroplastic NAD(P)H-quinone oxidoreductase functions?

Several emerging technologies offer exceptional promise for advancing our understanding of chloroplastic NAD(P)H-quinone oxidoreductase functions. Cryo-electron microscopy has revolutionized structural biology by enabling visualization of proteins in near-native states without crystallization, potentially revealing dynamic conformational changes during catalysis. This approach would be particularly valuable for understanding how the enzyme interacts with membrane components in the chloroplast. Single-molecule enzymology techniques allow direct observation of individual enzyme molecules, revealing heterogeneity in catalytic behavior and transient intermediates that are masked in bulk measurements. These approaches could elucidate the detailed kinetic mechanisms of quinone reduction and potential interactions with other chloroplast proteins .

CRISPR/Cas-based genome editing permits precise modification of NAD(P)H-quinone oxidoreductase genes in their native genomic context, enabling creation of plants with specific mutations to test structure-function hypotheses. Advances in metabolomics and redox proteomics facilitate comprehensive profiling of quinone/hydroquinone ratios and protein redox states in response to genetic modifications or environmental stresses, providing systems-level insights into enzyme function. Optogenetic tools offer the exciting possibility of light-controlled activation or inhibition of the enzyme, allowing unprecedented temporal control for studying its roles in rapid redox responses within the chloroplast. Integration of these technologies with computational approaches like molecular dynamics simulations and machine learning will likely accelerate discovery and provide a more complete understanding of this multifunctional enzyme .

What are the potential applications of understanding NAD(P)H-quinone oxidoreductase function for crop improvement and biotechnology?

Understanding NAD(P)H-quinone oxidoreductase function offers numerous exciting applications for crop improvement and biotechnology. Enhanced stress tolerance represents a primary application, as optimized NAD(P)H-quinone oxidoreductase variants could be engineered to improve plant resilience against multiple abiotic stresses through more efficient ROS management. Targeted overexpression in chloroplasts could enhance photosynthetic efficiency under stress conditions by protecting photosynthetic machinery from oxidative damage, potentially increasing crop yields in suboptimal environments. Based on the enzyme's involvement in disease resistance pathways and immunomodulatory functions, engineering NAD(P)H-quinone oxidoreductase activity could enhance plant immunity against pathogens, reducing reliance on chemical pesticides .

The enzyme's ability to metabolize various quinones makes it valuable for phytoremediation applications, potentially enabling plants to detoxify environmental pollutants containing quinone moieties. In biotechnology, engineered NAD(P)H-quinone oxidoreductases could serve as biocatalysts for fine chemical production, performing regioselective reductions of complex quinones to produce valuable hydroquinone derivatives for pharmaceutical or industrial applications. The maquette approach to protein engineering provides a framework for creating designer oxidoreductases with novel functions beyond those found in nature . Additionally, understanding the enzyme's regulatory mechanisms could lead to development of molecular switches responsive to specific environmental cues, enabling precise control of transgene expression in agricultural biotechnology applications. These diverse applications highlight the significant potential impact of research on this versatile enzyme family .

How might systems biology approaches contribute to a more comprehensive understanding of NAD(P)H-quinone oxidoreductase in plant stress response networks?

Systems biology approaches offer powerful tools for developing a comprehensive understanding of NAD(P)H-quinone oxidoreductase within plant stress response networks. Multi-omics integration combining transcriptomics, proteomics, metabolomics, and phenomics data from plants under various stress conditions can reveal how NAD(P)H-quinone oxidoreductase expression and activity correlate with broader cellular responses. This integration helps identify genes co-regulated with the oxidoreductase and metabolites affected by its activity, providing insights into its regulatory network and downstream effects. Network modeling using weighted gene co-expression network analysis (WGCNA) or similar approaches can position the enzyme within larger stress response networks, identifying important hub genes and regulatory connections that might not be apparent from studying the enzyme in isolation .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.