Recombinant Brachypodium distachyon NAD (P)H-quinone oxidoreductase subunit 6, chloroplastic

What is NAD(P)H-quinone oxidoreductase in Brachypodium distachyon and how does it function in chloroplasts?

NAD(P)H-quinone oxidoreductase in Brachypodium distachyon is a multi-subunit enzyme complex found in chloroplasts that catalyzes the transfer of electrons from NAD(P)H to quinones. This complex plays a crucial role in the electron transport chain within chloroplasts, contributing to energy production during photosynthesis. The enzyme couples electron transfer with ion translocation across membranes, creating electrochemical gradients used for ATP synthesis. In Brachypodium distachyon, a model grass species also known as Purple false brome, this enzyme functions similarly to related complexes in other plant species but exhibits specific adaptations related to its evolutionary position .

What are the structural characteristics of recombinant NAD(P)H-quinone oxidoreductase subunits in Brachypodium?

Recombinant NAD(P)H-quinone oxidoreductase subunits from Brachypodium distachyon typically maintain specific structural features necessary for their function. Based on related subunits, these proteins contain characteristic domains for cofactor binding, electron transport, and protein-protein interactions within the complex. For instance, subunit 3 consists of 120 amino acids with the sequence: MFLLHEYDIFWTFLIIASLIPILAFWISGLLAPISEGPEKLSSYESGIEPMGGAWLQFRIRYYMFALVFVVFDVETVFLYPWAMSFDVLGVSVFIEAFIFVLILVVGLVYAWRKGALEWS .

The structure typically includes transmembrane regions that anchor the protein within the chloroplast membrane and contribute to ion translocation mechanisms. While specific structural data for subunit 6 is limited, recombinant forms are typically expressed with fusion tags (such as His-tags) to facilitate purification and experimental manipulation without compromising the protein's functional domains .

How does NAD(P)H-quinone oxidoreductase compare between Brachypodium and other plant species?

NAD(P)H-quinone oxidoreductase shows considerable conservation in core functions across plant species while displaying taxon-specific adaptations. In Brachypodium distachyon, as a model grass species, the enzyme complex shares structural similarities with those found in other monocots but differs from dicot equivalents in specific amino acid sequences and regulatory mechanisms.

The chloroplastic NAD(P)H-quinone oxidoreductase components in Brachypodium are encoded by both nuclear and chloroplast genomes, similar to other plants. For instance, the ndhC gene encodes subunit 3 of this complex and shows high conservation across species while maintaining species-specific adaptations . Sequence variations between species correlate with evolutionary relationships and environmental adaptations, making comparative studies valuable for understanding both functional conservation and divergence in photosynthetic mechanisms across plant lineages.

What expression systems are most effective for producing recombinant Brachypodium NAD(P)H-quinone oxidoreductase subunits?

E. coli expression systems have proven highly effective for producing recombinant Brachypodium NAD(P)H-quinone oxidoreductase subunits with good yield and purity. Specifically, bacterial expression systems using E. coli strains optimized for membrane protein expression (such as C41(DE3) or C43(DE3)) provide suitable platforms for expressing these chloroplastic proteins. The inclusion of N-terminal or C-terminal affinity tags, particularly His-tags, facilitates subsequent purification while maintaining protein functionality .

For optimal expression, the following methodological approach is recommended:

• Gene optimization: Codon optimization for E. coli usage while preserving critical structural motifs

• Vector selection: pET-based vectors with T7 promoter systems for controlled induction

• Expression conditions: Induction at lower temperatures (16-20°C) for extended periods (16-20 hours) to enhance proper folding

• Media supplementation: Addition of specific ions or cofactors that facilitate proper folding and stability

Expression yields of greater than 90% purity can be achieved using this approach, as demonstrated with related subunits .

What purification protocols yield the highest activity for recombinant NAD(P)H-quinone oxidoreductase components?

To obtain highest-activity preparations of recombinant NAD(P)H-quinone oxidoreductase components, a multi-step purification protocol is recommended:

• Initial capture: Immobilized metal affinity chromatography (IMAC) using Ni-NTA resins for His-tagged proteins, with elution using imidazole gradient (50-250 mM)

• Intermediate purification: Ion exchange chromatography to separate based on charge properties

• Polishing: Size exclusion chromatography to remove aggregates and ensure homogeneity

• Buffer optimization: Tris/PBS-based buffers with 6% trehalose at pH 8.0 have been demonstrated to maintain stability

Activity preservation requires careful handling, including:

• Minimizing freeze-thaw cycles

• Storing working aliquots at 4°C for short-term (up to one week)

• Long-term storage at -20°C/-80°C in the presence of 5-50% glycerol (with 50% being optimal for many preparations)

For reconstitution, centrifugation prior to opening followed by reconstitution in deionized sterile water to 0.1-1.0 mg/mL with glycerol addition proves most effective for maintaining enzymatic activity .

How can enzyme kinetics be accurately measured for NAD(P)H-quinone oxidoreductase from Brachypodium?

Accurate kinetic measurements for NAD(P)H-quinone oxidoreductase from Brachypodium require carefully designed spectrophotometric assays that monitor either NAD(P)H oxidation or quinone reduction. A methodological approach should include:

• Reaction monitoring: Track NAD(P)H oxidation by measuring absorbance decrease at 340 nm or follow quinone reduction using specific wavelengths for the quinone substrate

• Reaction conditions:

  • Temperature control (typically 25-30°C)

  • pH optimization (usually pH 7.4-8.0)

  • Ionic strength adjustment

• Data collection: Continuous readings for initial velocity determination, avoiding substrate depletion effects

• Kinetic parameter extraction: Determine the Michaelis constant (Km) and maximum velocity (Vmax) using Michaelis-Menten equation fitting

The following reaction components are typically used:

• Enzyme: 0.1-10 μg of purified recombinant protein

• NAD(P)H: 10-500 μM (varied for Km determination)

• Quinone substrate: 1-100 μM (varied for Km determination)

• Buffer: 50 mM Tris-HCl, pH 7.5-8.0

• Additional components: 100 mM NaCl, 0.1 mM EDTA

Data analysis should employ appropriate software for non-linear regression fitting to obtain reliable kinetic parameters, with special attention to potential substrate inhibition at higher quinone concentrations .

How does the conformation of NAD(P) bound to oxidoreductase enzymes affect catalytic activity?

The conformation of NAD(P) bound to oxidoreductase enzymes critically influences catalytic activity through multiple structural factors. Research comparing NAD conformations across different enzyme classes reveals that oxidoreductase enzymes typically maintain NAD(P) in conformations optimized for electron transfer functions. This contrasts with other NAD-utilizing enzymes like diphtheria toxin (an ADP-ribosylating enzyme) where NAD adopts more unusual conformations .

Key conformational features affecting catalytic activity include:

Research comparing NAD conformations across 23 distinct NAD(P)-binding oxidoreductase enzymes found consistent patterns optimized for electron transfer function, with notable conservation in the positioning of critical atoms involved in redox chemistry .

What are the key differences in electron transfer mechanisms between different subunits of NAD(P)H-quinone oxidoreductase?

The electron transfer mechanisms between different subunits of NAD(P)H-quinone oxidoreductase involve a sophisticated relay of electrons through various redox cofactors. Based on studies of similar Na+-pumping NADH-ubiquinone oxidoreductase (Na+-NQR) systems, the electron transfer pathway likely follows a specific sequence through multiple cofactors distributed across different subunits .

The general electron transfer pathway follows:
NADH → FAD → 2Fe-2S cluster → FMN → FMN → riboflavin → ubiquinone (UQ)

Key differences between subunits include:

• Cofactor composition: Different subunits host specific cofactors, such as FAD in one subunit, 2Fe-2S clusters at the junction between others, and covalently bound FMNs in yet others .

• Structural arrangements: High-resolution structures (2.5-3.1 Å) reveal that some regions, particularly hydrophilic domains, show high flexibility, which may be functionally important for reducing electron transfer distances between cofactors in different subunits during catalytic turnover .

• Conformational dynamics: Some subunits undergo significant conformational changes during the catalytic cycle to decrease spatial gaps between cofactors, which would otherwise be too long (29-32 Å edge-to-edge) to support physiologically relevant electron transfer .

This complex arrangement of electron carriers across multiple subunits enables the coupling of electron transfer with ion translocation, a fundamental aspect of the enzyme's bioenergetic function .

How can site-directed mutagenesis be used to study the function of specific amino acid residues in NAD(P)H-quinone oxidoreductase?

Site-directed mutagenesis provides a powerful approach for investigating specific amino acid residues in NAD(P)H-quinone oxidoreductase. This methodology enables precise modification of protein structure to determine the functional importance of individual residues in catalysis, cofactor binding, subunit interactions, and ion translocation.

A comprehensive site-directed mutagenesis study should include:

This approach has revealed critical residues in related oxidoreductase enzymes, including those involved in quinone binding pockets, cofactor coordination, and electron transfer pathways .

What challenges are associated with maintaining stability of recombinant NAD(P)H-quinone oxidoreductase during purification and storage?

Maintaining stability of recombinant NAD(P)H-quinone oxidoreductase during purification and storage presents several challenges due to the protein's complex structure and cofactor requirements. Primary stability challenges include:

• Protein aggregation during concentration steps

• Loss of cofactors during purification

• Oxidative damage to redox-sensitive residues

• Conformational instability in solution

• Activity loss during freeze-thaw cycles

These challenges can be methodically addressed through:

Optimized Buffer Composition:

• Inclusion of 6% trehalose in Tris/PBS-based storage buffers (pH 8.0) provides significant stabilization

• Addition of reducing agents (1-5 mM DTT or 2-10 mM β-mercaptoethanol) to prevent oxidative damage

• Presence of glycerol (5-50%) for cryoprotection, with 50% being optimal for long-term storage

Storage and Handling Protocols:

• Aliquoting to avoid repeated freeze-thaw cycles

• Storage at -20°C/-80°C for long-term preservation

• Maintaining working aliquots at 4°C for up to one week

• Brief centrifugation before opening to bring contents to the bottom of the container

Reconstitution Methods:

• Reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL

• Gentle mixing rather than vigorous agitation to prevent aggregation

Implementing these approaches has been demonstrated to maintain enzyme activity during purification and storage, with greater than 90% purity achievable using appropriate techniques .

How can researchers address the challenge of low expression yields for membrane-associated subunits?

Membrane-associated subunits of NAD(P)H-quinone oxidoreductase often present significant expression challenges due to their hydrophobic regions and complex folding requirements. To overcome low expression yields, researchers can implement a systematic optimization approach:

• Expression system refinement:

  • Test specialized E. coli strains designed for membrane protein expression (C41(DE3), C43(DE3), Lemo21(DE3))

  • Consider eukaryotic expression systems (insect cells, yeast) for particularly challenging subunits

  • Explore cell-free expression systems with added lipids or detergents

• Vector and construct design improvements:

  • Optimize codon usage for expression host

  • Include solubility-enhancing fusion partners (MBP, SUMO, Trx)

  • Test different positions for affinity tags (N-terminal, C-terminal, internal)

  • Create truncation constructs that remove highly hydrophobic regions while retaining functional domains

• Induction and growth condition optimization:

  • Reduce induction temperature (16-20°C) to slow protein synthesis and improve folding

  • Decrease inducer concentration to reduce expression rate

  • Extend post-induction time (16-24 hours) to accumulate more protein

  • Test different media compositions including specific ion supplementation

• Co-expression strategies:

  • Co-express with chaperones to assist proper folding (GroEL/ES, DnaK/J)

  • Co-express with other subunits to facilitate complex formation

  • Include specific cofactors in growth media to promote proper folding

These approaches have demonstrated significant improvements in expressing challenging membrane proteins, with yields increasing from undetectable levels to several milligrams per liter of culture when systematically optimized .

What techniques can be used to reconstitute functional NAD(P)H-quinone oxidoreductase complexes from individual recombinant subunits?

Reconstituting functional multi-subunit NAD(P)H-quinone oxidoreductase complexes from individually expressed and purified recombinant subunits requires specific techniques to ensure proper assembly and activity. A methodological approach should include:

• Subunit preparation:

  • Purify individual subunits under conditions that maintain their native conformations

  • Verify purity (>90% by SDS-PAGE) and preliminary folding (by circular dichroism)

  • Remove affinity tags if they interfere with complex assembly

  • Maintain all subunits in compatible buffer systems

• Assembly conditions optimization:

  • Screen buffer compositions varying pH (7.0-8.5), salt concentrations (50-500 mM), and additives

  • Test different subunit ratios (stoichiometric vs. excess of certain components)

  • Introduce assembly in stepwise fashion versus all-at-once approach

  • Include specific lipids or detergents to mimic membrane environment

• Cofactor incorporation:

  • Add essential cofactors (FAD, FMN, 2Fe-2S) during or after subunit mixing

  • Test different methods for iron-sulfur cluster reconstitution if needed

  • Verify cofactor binding using spectroscopic methods

• Validation of assembled complexes:

  • Size-exclusion chromatography to confirm appropriate complex size

  • Blue native PAGE to analyze intact complexes

  • Negative-stain electron microscopy for structural verification

  • Activity assays measuring electron transfer from NADH to quinone substrates

• Membrane incorporation:

  • Reconstitute complexes into liposomes or nanodiscs for functional studies

  • Test different lipid compositions to optimize activity

  • Measure oriented insertion using proteoliposome-based assays

This systematic approach has been successful for reconstituting related multi-subunit membrane protein complexes from individual components while maintaining functional integrity .

How can structural information about NAD(P)H-quinone oxidoreductase inform the development of agricultural biotechnology?

Structural insights into NAD(P)H-quinone oxidoreductase from Brachypodium distachyon can significantly advance agricultural biotechnology through several research applications:

These applications depend on high-resolution structural data combined with functional validation, potentially leading to crops with improved yield, stress tolerance, and reduced environmental impact .

What are the emerging techniques for studying real-time electron transfer in NAD(P)H-quinone oxidoreductase complexes?

Emerging techniques for studying real-time electron transfer in NAD(P)H-quinone oxidoreductase complexes are revolutionizing our understanding of these complex bioenergetic systems. Cutting-edge methodological approaches include:

• Time-resolved spectroscopy:

  • Ultrafast transient absorption spectroscopy with femtosecond resolution to track electron movements between cofactors

  • Pulse radiolysis combined with rapid spectroscopic detection to initiate and monitor specific electron transfer steps

  • Time-resolved fluorescence spectroscopy using strategic fluorophore placement to monitor conformational changes during electron transfer

• Advanced structural methods:

  • Time-resolved cryo-electron microscopy (cryo-EM) to capture different conformational states during the catalytic cycle

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to identify dynamic regions during electron transfer

  • Single-particle tracking to observe conformational changes in individual enzyme complexes

• Site-specific probes:

  • Incorporation of unnatural amino acids with spectroscopic properties at specific sites

  • Strategic placement of paramagnetic probes for electron paramagnetic resonance (EPR) studies

  • Vibrational spectroscopy using site-specific isotope labeling to monitor local environmental changes during electron transfer

• Computational approaches:

  • Quantum mechanical/molecular mechanical (QM/MM) simulations to model electron transfer pathways

  • Machine learning algorithms to identify patterns in experimental data and predict electron transfer rates

  • Molecular dynamics simulations to understand protein motion during the catalytic cycle

These techniques are revealing unprecedented details about the mechanisms of electron transfer, including the identification of rate-limiting steps, the role of protein dynamics, and the influence of specific amino acid residues on electron tunneling pathways .

How can comparative studies of NAD(P)H-quinone oxidoreductase across species inform evolutionary understanding of photosynthetic systems?

Comparative studies of NAD(P)H-quinone oxidoreductase across species provide valuable insights into the evolution of photosynthetic systems and bioenergetic mechanisms. This research approach reveals evolutionary patterns through:

• Sequence and structural conservation analysis:

  • Identification of universally conserved residues across phylogenetic distances indicates fundamental functional importance

  • Lineage-specific variations highlight adaptive modifications in different environmental niches

  • Mapping conservation patterns onto structural models reveals evolutionary constraints on specific functional domains

• Cofactor utilization patterns:

  • Analysis of cofactor binding sites across species illuminates the evolution of electron transfer chains

  • Comparison of NAD(P)H preferences between species reflects evolutionary adaptations to different metabolic contexts

  • Variations in quinone binding specificity demonstrate adaptation to different electron acceptors available in various environments

• Subunit composition evolution:

  • Tracking changes in subunit number and arrangement across evolutionary lineages

  • Identifying fusion and fission events in gene evolution that have shaped the modern complex

  • Analyzing co-evolution patterns between interacting subunits

• Functional adaptation mechanisms:

  • Comparative kinetic studies revealing species-specific optimizations for different environmental conditions

  • Correlation of structural modifications with habitat-specific challenges

  • Identification of convergent evolutionary solutions to similar bioenergetic challenges

The integration of structural, functional, and genomic data across species from Brachypodium to other plants and even bacterial systems provides a comprehensive picture of how these essential bioenergetic complexes have evolved. Such comparative approaches are particularly valuable when examining model organisms like Brachypodium distachyon that serve as evolutionary bridges between crop species and more distant relatives .

What are common pitfalls in recombinant NAD(P)H-quinone oxidoreductase expression and how can they be overcome?

Recombinant expression of NAD(P)H-quinone oxidoreductase components presents several common challenges that can be systematically addressed through specific methodological interventions:

Additional specific troubleshooting approaches include:

• For expression issues:

  • Optimize codon usage for expression host

  • Verify construct sequence integrity before expression

  • Test multiple expression strains in parallel

  • Evaluate different fusion tags and their positions

• For purification challenges:

  • Implement rapid purification protocols to minimize time

  • Use stabilizing buffer systems containing 6% trehalose

  • Evaluate detergent types and concentrations for membrane-associated subunits

  • Include cofactors in purification buffers to maintain proper folding

• For activity restoration:

  • Reconstitute in buffers optimized for enzyme stability and function

  • Verify proper oligomeric state using size exclusion chromatography

  • Ensure appropriate reducing conditions for maintaining cofactor redox state

  • Add specific lipids when needed for membrane-associated components

These approaches have been demonstrated to significantly improve the yield and quality of recombinant NAD(P)H-quinone oxidoreductase components from various sources, with purities exceeding 90% achievable through optimized protocols .

How can researchers validate the functionality of reconstituted NAD(P)H-quinone oxidoreductase complexes?

Comprehensive validation of reconstituted NAD(P)H-quinone oxidoreductase complexes requires a multi-faceted approach that addresses structural integrity, cofactor incorporation, and functional activity:

• Structural validation methods:

  • Size exclusion chromatography to confirm appropriate complex size and homogeneity

  • Blue native PAGE to analyze intact complexes under non-denaturing conditions

  • Analytical ultracentrifugation to determine precise oligomeric state

  • Negative-stain electron microscopy or cryo-EM for structural confirmation

  • Limited proteolysis to assess proper folding and subunit interactions

• Cofactor incorporation assessment:

  • UV-visible spectroscopy to verify characteristic absorbance peaks for flavins and iron-sulfur clusters

  • Fluorescence spectroscopy to confirm flavin incorporation

  • Electron paramagnetic resonance (EPR) spectroscopy to validate iron-sulfur cluster assembly

  • Metal content analysis using inductively coupled plasma mass spectrometry (ICP-MS)

• Functional activity characterization:

  • NADH:quinone oxidoreductase activity assays measuring rates of NAD(P)H oxidation

  • Quinone reduction monitoring using specific wavelengths for various quinone substrates

  • Oxygen consumption measurements when relevant

  • Ion translocation assays for complexes coupling electron transfer to ion movement

  • Inhibitor sensitivity profiles comparing to native enzyme complexes

• Quantitative validation metrics:

  • Specific activity (μmol substrate converted per minute per mg protein)

  • Turnover number (molecules of substrate converted per enzyme molecule per second)

  • Km values for NAD(P)H and quinone substrates

  • IC50 values for known inhibitors

These validation approaches provide comprehensive evidence for proper assembly and function of reconstituted complexes, ensuring that experimental results accurately reflect the properties of the native enzyme systems .

How can inconsistencies in enzyme activity measurements between different laboratories be reconciled?

Reconciling inconsistencies in enzyme activity measurements between different laboratories requires systematic analysis of methodological variables and implementation of standardized protocols. Key approaches include:

• Standardization of activity assay conditions:

  • Define precise buffer composition, pH, and ionic strength

  • Establish temperature control parameters (±0.1°C)

  • Standardize substrate preparation methods and storage

  • Define specific spectrophotometer settings (bandwidth, scan rate, etc.)

• Enzyme preparation harmonization:

  • Implement consistent purification protocols

  • Standardize protein concentration determination methods

  • Define storage conditions and acceptable freeze-thaw cycles

  • Establish reconstitution procedures for lyophilized preparations

• Reference materials and controls:

  • Distribute common reference enzyme preparations between laboratories

  • Use internal standards to normalize between instruments

  • Implement positive and negative control reactions in each assay

  • Develop laboratory proficiency testing programs

• Data analysis standardization:

  • Define acceptable methods for initial rate determination

  • Standardize curve-fitting approaches for kinetic parameter extraction

  • Establish statistical methods for outlier identification

  • Implement consistent methods for calculating and reporting errors

• Systematic variation analysis:

  • Conduct inter-laboratory comparison studies with identical samples

  • Perform method robustness testing across multiple parameters

  • Quantify the impact of specific methodological variations

  • Document all deviations from standard protocols

These approaches can significantly reduce inter-laboratory variation and enable more reliable comparison of enzyme activity data across studies. Implementation of these standardization efforts has successfully reconciled inconsistencies in kinetic measurements for other enzyme systems and could be productively applied to NAD(P)H-quinone oxidoreductase research .