Recombinant Brachypodium distachyon Photosystem II CP47 chlorophyll apoprotein (psbB)

Shipped with Ice Packs
In Stock

Description

Production and Purity

Recombinant psbB is produced via heterologous expression systems, with purity typically exceeding 85% (SDS-PAGE). Common hosts include:

Host SystemPurityExpression PlatformNotesSource
E. coli≥85%Bacterial fermentationCost-effective, scalable
Yeast≥85%Eukaryotic post-translational modificationEnhanced folding/stability
Baculovirus/Mammalian≥85%Insect cell/bioreactor systemsHigh yield, complex folding
Cell-Free≥85%In vitro translationRapid production, minimal contamination

Spinach-derived psbB (e.g., Creative Biomart’s His-tagged variant) achieves >90% purity, serving as a benchmark for structural studies .

PSII Assembly and Mutant Studies

  • Mutant Phenotypes: pam71 mutants in Brachypodium show reduced psbB levels (~50% of wild-type), impairing PSII supercomplex formation and electron transport .

  • Biomass Allocation: Under phosphorus stress, Brachypodium prioritizes root growth, but psbB mutants fail to recover shoot productivity .

Genetic Tools and Functional Genomics

  • Reference Genes: While psbB is not a reference gene, UBC18 (ubiquitin-conjugating enzyme) is validated for normalizing gene expression in Brachypodium .

  • Transformation Efficiency: Agrobacterium-mediated transformation enables psbB overexpression studies in Brachypodium, aiding biofuel crop development .

Comparative Evolutionary Analysis

The psbB gene in Brachypodium exhibits accelerated evolution compared to other grasses (e.g., rice, wheat), with deletions in the rbcL-psaI spacer region . This divergence may reflect adaptive responses to environmental stresses.

Future Directions

  • Biofuel Applications: Engineering psbB to enhance PSII stability could improve photosynthetic efficiency in bioenergy crops.

  • Structural Studies: High-resolution crystallography of Brachypodium psbB could elucidate chlorophyll binding dynamics, advancing synthetic biology tools.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it in your order notes. We will accommodate your request if possible.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timeframes.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate this in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol final concentration is 50%, which you can use as a reference.
Shelf Life
The shelf life of the protein is influenced by several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us and we will prioritize its development.
Synonyms
psbB; Photosystem II CP47 reaction center protein; PSII 47 kDa protein; Protein CP-47
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-508
Protein Length
full length protein
Species
Brachypodium distachyon (Purple false brome) (Trachynia distachya)
Target Names
psbB
Target Protein Sequence
MGLPWYRVHTVVLNDPGRLLAVHIMHTALVSGWAGSMALYELAVFDPSDPVLDPMWRQGM FVIPFMTRLGITDSWGGWSISGGTVTNPGIWSYEGVAGTHIVFSGLCFLAAIWHWVYWDL AIFSDDRTGKPSLDLPKIFGIHLFLAGVACFGFGAFHVTGLYGPGIWVSDPYGLTGKVQA VNPAWGAEGFDPFVPGGIASHHIAAGTLGILAGLFHLSVRPPQRLYKGLRMGNIETVLSS SIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDQGYFQQEIYRRVSNGLSENLSLSE AWSKIPEKLAFYDYIGNNPAKGGLFRAGSMDNGDGIAVGWLGHPVFRDKEGRELFVRRMP TFFETFPVVLVDEEGIVRADVPFRRAESKYSVEQVGVTVEFYGGELNGVSYSDPATVKKY ARRSQLGEIFELDRATLKSDGVFRSSPRGWFTFGHATFALLFFFGHIWHGARTLFRDVFA GIDPDLDAQVEFGTFQKVGDPTTRKQAV
Uniprot No.

Target Background

Function
CP47 (chlorophyll apoprotein, encoded by the psbB gene) is a key component of the core complex in photosystem II (PSII). It binds chlorophyll and plays a crucial role in catalyzing the initial light-induced photochemical reactions of PSII. PSII is a light-driven water:plastoquinone oxidoreductase, utilizing light energy to extract electrons from water, generating oxygen and a proton gradient, which is subsequently used for ATP formation.
Database Links
Protein Families
PsbB/PsbC family, PsbB subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the structural and functional role of CP47 in Photosystem II?

CP47 functions as one of the key large structural components of Photosystem II (PSII) embedded in thylakoid membranes. As a chlorophyll (Chl)-binding protein, it forms part of the core complex alongside D1, D2, and CP43 proteins. CP47 primarily serves as an internal antenna that captures light energy and transfers it to the reaction center. The protein is assembled into PSII through a stepwise process, forming what is termed the "CP47 assembly module" (CP47m), which attaches to the reaction center II (RCII) complex to form an intermediate complex called "RC47" . This assembly process is critical for developing functional PSII complexes capable of oxygen evolution.

How does the amino acid sequence of Brachypodium distachyon CP47 compare to model organisms?

While the search results don't provide the specific sequence for Brachypodium distachyon CP47, we can infer from related research that it likely shares significant homology with other plant species. For comparison, the Draba nemorosa CP47 protein consists of 508 amino acids with a specific sequence detailed in the available literature . Sequence alignment analysis would reveal conservation patterns across species, which is particularly important when designing experiments or interpreting results across different plant models. Researchers should conduct bioinformatic analyses to determine the degree of conservation between Brachypodium and other well-studied species before extrapolating functional data.

What expression systems are typically used for recombinant CP47 production?

Recombinant CP47 proteins are commonly expressed using prokaryotic expression systems, with E. coli being a prevalent choice. For example, recombinant full-length Draba nemorosa CP47 protein is expressed in E. coli with an N-terminal His tag for purification purposes . When working with Brachypodium distachyon CP47, researchers should optimize expression conditions including temperature, induction timing, and media composition to achieve proper folding of this membrane protein. The expression construct typically includes affinity tags (such as His-tag) to facilitate subsequent purification steps, though care must be taken as tags may affect protein functionality in some assays.

What are the best practices for experimental design when studying recombinant CP47 function?

When designing experiments to study recombinant CP47 from Brachypodium distachyon, researchers should follow randomized controlled design principles to minimize bias. The ideal approach involves:

  • Clearly defined treatment and control groups with random assignment

  • Appropriate technical and biological replicates to account for variability

  • Double-blinding where possible to eliminate observer bias

  • Inclusion of suitable positive and negative controls

As noted in experimental design literature, "Randomization is best!" because it eliminates human bias and helps ensure that treatment and control groups are as alike as possible . When studying CP47 function, researchers should randomize samples across different experimental conditions and measurement time points. Additionally, blocking designs may be appropriate when known sources of variation (such as protein batch effects) exist and need to be controlled for in the analysis.

What purification methods yield the highest quality recombinant CP47 protein?

Purification of recombinant CP47 typically follows a multi-step process designed to maintain protein integrity while achieving high purity:

  • Initial affinity chromatography using the protein's His-tag to capture the target protein

  • Ion-exchange chromatography to separate based on charge differences

  • Size-exclusion chromatography for final polishing and buffer exchange

The quality of purified protein should be assessed via SDS-PAGE, with purity typically exceeding 90% . For storage, researchers should avoid repeated freeze-thaw cycles as this can compromise protein integrity. The recommended storage approach includes:

  • Aliquoting the purified protein to avoid repeated freeze-thaw cycles

  • Storage at -20°C/-80°C for long-term stability

  • Using a Tris/PBS-based buffer with 6% Trehalose at pH 8.0

  • Adding glycerol (typically 30-50% final concentration) as a cryoprotectant

For reconstitution, proteins should be dissolved in deionized sterile water to a concentration of 0.1-1.0 mg/mL before experimental use .

How can researchers investigate CP47 assembly into functional Photosystem II complexes?

Investigating CP47 assembly into functional PSII complexes requires sophisticated biochemical and biophysical techniques. The assembly process follows a modular pattern where the CP47 module attaches to the reaction center II complex . To study this process:

  • Use pulse-chase labeling with isotopes to track newly synthesized CP47

  • Employ blue-native PAGE to separate intact PSII assembly intermediates

  • Perform co-immunoprecipitation studies to identify interaction partners

  • Utilize time-resolved spectroscopy to monitor chlorophyll integration

Researchers should pay particular attention to auxiliary proteins like Pam68, which has been shown to bind ribosomes near the SecY translocon and likely promotes chlorophyll loading into the CP47 polypeptide chain . This represents a critical step in CP47 biogenesis and subsequent PSII assembly. When designing experiments to study assembly factors, consider knockout/knockdown approaches combined with complementation studies to determine functional significance.

What approaches can be used to study the effects of abiotic stress on CP47 structure and function in Brachypodium distachyon?

Brachypodium distachyon has been established as a model for studying plant responses to abiotic stresses, including heat and drought . When investigating stress effects on CP47:

  • Design factorial experiments testing combined stresses (e.g., heat × drought)

  • Monitor changes in CP47 abundance using quantitative proteomics

  • Assess alterations in protein-pigment interactions using spectroscopic methods

  • Evaluate photosystem II efficiency through chlorophyll fluorescence measurements

Studies have shown that some SNPs significantly associated with responses to individual stresses (heat or drought) are also significantly associated with combined stress responses . This suggests potential genetic mechanisms underlying CP47 adaptation to multiple stresses. High-throughput phenotyping approaches can be particularly valuable for identifying subtle effects of stress on photosystem function across natural variation in Brachypodium populations.

How can researchers manipulate chlorophyll binding to CP47 to investigate antenna size effects?

The antenna size of photosystems significantly impacts light-harvesting efficiency. Researchers can manipulate chlorophyll binding to CP47 through several approaches:

  • Overexpression of chlorophyllide a oxygenase (CAO) to increase chlorophyll b synthesis

  • Site-directed mutagenesis of specific chlorophyll-binding residues in CP47

  • Modulation of auxiliary factors like Pam68 that facilitate chlorophyll integration

Previous research has demonstrated that overexpression of CAO can reduce the chlorophyll a:b ratio from 2.85 to 2.65 and increase the ratio of peripheral light-harvesting complexes (LHCII) to core antenna complex (CPa) by approximately 20% . This approach effectively enlarges the antenna size by 10-20% in transgenic plants. When applying similar strategies to Brachypodium distachyon, researchers should carefully characterize any resulting changes in:

What methods can be used to compare CP47 function across different plant species?

Comparative analysis of CP47 across plant species requires multi-faceted approaches:

TechniqueApplicationOutput Metrics
Sequence alignmentEvolutionary conservationPercent identity, conserved domains
Structural modeling3D conformation comparisonRMSD values, binding site conservation
Functional assaysPhotochemical efficiencyQuantum yield, electron transport rates
Expression analysisTranscript abundance patternsTPM values, expression correlation

How do mutations in the psbB gene affect CP47 assembly and function?

Mutations in psbB can have profound effects on CP47 assembly and PSII function. To investigate these effects:

  • Generate targeted mutations using CRISPR/Cas9 or identify natural variants

  • Assess protein accumulation through immunoblotting against CP47 and interacting partners

  • Evaluate PSII complex formation using native PAGE techniques

  • Measure photosynthetic parameters to quantify functional impacts

How can researchers resolve contradictory results in CP47 functional studies?

Contradictory results in CP47 research may stem from multiple sources:

  • Different experimental conditions (temperature, light intensity, growth medium)

  • Variation in protein preparation methods affecting folding or pigment content

  • Species-specific differences when comparing across plant models

  • Technical variation in measurement approaches

To resolve contradictions, researchers should:

  • Standardize experimental protocols across laboratories

  • Conduct side-by-side comparisons under identical conditions

  • Utilize statistical approaches to identify significant effects versus random variation

  • Consider meta-analysis of published data when sufficient studies exist

Following robust experimental design principles with appropriate randomization helps eliminate bias that might lead to contradictory results . When analyzing complex datasets, researchers should be attentive to potential confounding factors and interaction effects that might explain apparent contradictions in the literature.

What statistical approaches are appropriate for analyzing CP47 mutation effects in natural variation studies?

When analyzing natural variation in CP47 structure and function:

  • Employ mixed-effects models to account for genetic background variation

  • Use genome-wide association studies (GWAS) to identify SNPs associated with phenotypic variation

  • Apply multivariate analysis techniques to capture effects on multiple related traits

  • Implement permutation tests to establish significance thresholds

Studies of natural variation in Brachypodium distachyon have successfully identified SNPs associated with responses to abiotic stresses . Similar approaches can be applied to identify genetic variants affecting CP47 function across accessions. For complex datasets with multiple dependent variables, researchers should consider dimension reduction techniques like principal component analysis before statistical testing to avoid multiple testing problems.

What emerging technologies might advance our understanding of CP47 dynamics in vivo?

Several cutting-edge technologies show promise for deepening our understanding of CP47:

  • Cryo-electron microscopy for high-resolution structural analysis of PSII complexes in different assembly states

  • Single-molecule tracking to monitor CP47 movement and interactions within thylakoid membranes

  • Optogenetic approaches to manipulate CP47 function with spatial and temporal precision

  • Advanced mass spectrometry techniques for identifying post-translational modifications

These approaches could help resolve outstanding questions about how CP47 is integrated into functional PSII complexes and how its structure-function relationship changes under different environmental conditions or developmental stages.

How might engineered variations of CP47 improve photosynthetic efficiency?

Engineering CP47 for improved photosynthetic efficiency represents an exciting frontier. Potential approaches include:

  • Strategic amino acid substitutions to optimize chlorophyll orientation for enhanced energy transfer

  • Modifications to alter the chlorophyll a:b ratio within the protein

  • Engineering protein stability to maintain function under stress conditions

  • Adjusting antenna size through modified chlorophyll binding properties

Previous research has demonstrated that manipulating chlorophyll b synthesis through CAO overexpression can effectively enlarge antenna size by 10-20% . Building on this work, researchers could develop targeted approaches to modify specific aspects of CP47 structure that influence light harvesting efficiency or energy transfer to the reaction center. When designing such modifications for Brachypodium distachyon, researchers should consider both fundamental photochemical principles and the specific ecological adaptations of this grass species.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.