Recombinant Brachyspira hyodysenteriae Large-conductance mechanosensitive channel (mscL)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for custom preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Tag type is determined during production. To prioritize a specific tag, please inform us during your order placement.
Synonyms
mscL; BHWA1_00558; Large-conductance mechanosensitive channel
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-155
Protein Length
full length protein
Species
Brachyspira hyodysenteriae (strain ATCC 49526 / WA1)
Target Names
mscL
Target Protein Sequence
MIKEFKKFIMKGSILDMAVGLVIGAAFTKIVNSFVDDILMPPIGMILSGIDFSNIFIVIK KGTDTLGNYNSIEAARNAGAVVIGIGVFINAIISFIITALSLFIIIKLFNKIQEKTVKKE KDEKESKEKVCPYCYSSININAVKCPNCTSDLDVK
Uniprot No.

Target Background

Function

A mechanosensitive channel that opens in response to membrane lipid bilayer stretch forces. It may play a regulatory role in cellular osmotic pressure changes.

Database Links
Protein Families
MscL family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Brachyspira hyodysenteriae and why is its mscL protein significant?

Brachyspira hyodysenteriae is an anaerobic spirochaete that causes swine dysentery (SD), a severe mucohaemorrhagic colitis primarily affecting grower and fattener pigs . The large-conductance mechanosensitive channel (mscL) in B. hyodysenteriae is significant because membrane proteins like mscL play crucial roles in cellular adaptation to osmotic stress, potentially contributing to the pathogen's survival mechanisms during infection. Understanding the structure and function of this channel could provide insights into B. hyodysenteriae pathogenicity and potentially lead to novel therapeutic approaches.

How is the B. hyodysenteriae genome analyzed to identify proteins like mscL?

Bioinformatic analysis of the complete genome sequence of B. hyodysenteriae (such as strain WA1) is used to identify genes predicted to encode membrane proteins like mscL . This typically involves:

  • Whole genome sequencing and assembly

  • Gene prediction using computational tools

  • Functional annotation using homology searches against known protein databases

  • Identification of transmembrane domains and signal peptides

  • Comparative genomics with other bacterial species with characterized mscL proteins

Once identified, these genes can be cloned and expressed in systems like Escherichia coli for further study and characterization.

What expression systems are most effective for producing recombinant B. hyodysenteriae proteins?

For B. hyodysenteriae proteins, including membrane proteins like mscL, Escherichia coli-mediated expression systems have been successfully employed. This approach typically involves:

  • Gene amplification using PCR

  • Cloning into suitable expression vectors with histidine tags

  • Expression in E. coli under optimized conditions

  • Purification using affinity chromatography

For instance, in related research, multiple B. hyodysenteriae outer membrane proteins were expressed in an E. coli system and purified as histidine-tagged recombinant proteins for use as antigens in diagnostic tests .

What are the optimal conditions for expressing and purifying recombinant B. hyodysenteriae mscL?

While specific conditions for mscL expression are not detailed in the provided materials, general principles for membrane protein expression from B. hyodysenteriae would include:

Expression Optimization:

  • Temperature: Lower temperatures (16-25°C) often yield better results for membrane proteins

  • Induction: Low IPTG concentrations (0.1-0.5 mM)

  • Media: Enriched media such as Terrific Broth or autoinduction media

  • Host strains: C41(DE3), C43(DE3), or BL21(DE3) pLysS for toxic proteins

Purification Strategy:

  • Cell disruption using sonication or French press

  • Membrane fraction isolation by ultracentrifugation

  • Solubilization using appropriate detergents (DDM, LDAO, or C12E8)

  • Affinity purification using Ni-NTA for His-tagged proteins

  • Size exclusion chromatography for final purity

The specific conditions would need optimization through empirical testing for the mscL protein.

How can researchers verify the functionality of recombinant B. hyodysenteriae mscL?

Functional verification of recombinant mscL can be performed through multiple complementary approaches:

  • Patch-clamp electrophysiology: Reconstitute purified mscL in liposomes or planar lipid bilayers to measure channel conductance and gating properties under membrane tension.

  • Osmotic shock survival assays: Express mscL in mscL-deficient E. coli strains and test survival under hypoosmotic shock conditions.

  • Fluorescence-based assays: Incorporate fluorescent dyes into proteoliposomes containing mscL and monitor dye release upon osmotic downshift.

  • Structural analysis: Use techniques like circular dichroism to verify proper protein folding.

  • Biophysical interaction studies: Assess protein-lipid interactions using techniques like isothermal titration calorimetry or surface plasmon resonance.

These approaches collectively provide evidence of proper folding and channel function of the recombinant protein.

What gene transfer methods can be used to introduce modified mscL genes into B. hyodysenteriae?

Gene transfer in B. hyodysenteriae is challenging but several approaches have been documented:

  • VSH-1-mediated gene transfer: B. hyodysenteriae naturally produces VSH-1 particles that can transfer genetic material between strains. This bacteriophage-like agent can be induced with mitomycin C to increase transfer efficiency . As demonstrated in studies, gene transfer frequencies of approximately 360 CFU/ml were achieved in laboratory conditions .

  • Electroporation: Though challenging with spirochetes, optimized protocols with high voltage and extended pulse durations can be effective.

  • Suicide vectors: Non-replicating plasmids carrying the modified gene can integrate into the chromosome via homologous recombination.

Key considerations for gene transfer efficiency:

  • The use of VSH-1-specific antibodies can inhibit gene transfer, confirming the role of VSH-1 in natural genetic exchange

  • Addition of mitomycin C to cultures can result in a five-fold increase in genetic transfer efficiency by inducing VSH-1 production

How does the structure and function of B. hyodysenteriae mscL compare to those of other bacterial species?

While specific structural data for B. hyodysenteriae mscL is not provided in the search results, comparative analysis would typically include:

  • Sequence homology analysis: Alignment with well-characterized mscL proteins from E. coli, Mycobacterium tuberculosis, and other bacteria to identify conserved domains.

  • Structural prediction: Homology modeling based on solved crystal structures of mscL from other species.

  • Functional comparison: Electrophysiological characteristics including:

    • Conductance (typically 2-3 nS for mscL channels)

    • Tension threshold for activation

    • Ion selectivity (typically low cation preference)

    • Subconductance states during gating

  • Evolutionary conservation: Analysis of transmembrane domains, cytoplasmic helices, and periplasmic loops among spirochete mscL proteins.

A thorough understanding of these comparative aspects would highlight unique features of B. hyodysenteriae mscL that might be related to its pathogenicity or environmental adaptation.

What role might mscL play in B. hyodysenteriae pathogenesis and survival in host environments?

The mscL protein likely contributes to B. hyodysenteriae pathogenesis through multiple mechanisms:

  • Osmotic stress response: During transit through the digestive tract, B. hyodysenteriae encounters varying osmotic conditions. MscL would help protect against osmotic lysis when moving from higher to lower osmolarity environments.

  • Host immune evasion: Rapid adaptation to osmotic stress during phagocytosis could enhance survival within immune cells.

  • Colonization dynamics: B. hyodysenteriae must colonize the colon where it causes mucohaemorrhagic lesions . MscL may contribute to the adaptation required for successful colonization under changing environmental conditions.

  • Interaction with mucin: During infection, B. hyodysenteriae affects mucin production (including MUC5AC and MUC2) , potentially altering the osmotic environment. MscL could be involved in adapting to these changes.

  • Stress response coordination: MscL may be part of a broader stress response mechanism that includes other virulence factors.

Further research examining mscL knockout mutants would help elucidate its specific role in pathogenesis.

How can recombinant B. hyodysenteriae mscL be used to develop novel diagnostic tools or therapeutic targets?

Recombinant B. hyodysenteriae mscL could be leveraged for diagnostic and therapeutic applications through several approaches:

Diagnostic Applications:

  • Serological assays: Using purified recombinant mscL as an antigen in ELISA tests to detect antibodies in infected herds, similar to the approach with other B. hyodysenteriae outer membrane proteins .

  • PCR-based detection: Development of specific primers for mscL gene detection in clinical samples, potentially improving upon current diagnostic limitations where phenotypic characteristics may be more reliable indicators of virulence than current molecular identification methods .

Therapeutic Targets:

  • Channel blocker development: Screening for compounds that specifically inhibit B. hyodysenteriae mscL function.

  • Peptide inhibitors: Design of peptides that interact with the channel's gating mechanism based on structural insights.

  • Vaccine development: Evaluating mscL as a potential vaccine antigen, especially if it proves to be conserved among virulent strains and accessible to the immune system.

Data from related diagnostic development:

Diagnostic MethodSensitivitySpecificitySample TypeReference
ELISA (H114 antigen)91.7%100%Serum
Culture (mucosal scrapings)Higher than direct PCRN/AColon tissue
Direct PCR on mucosal scrapingsLower than cultureN/AColon tissue

What are the main challenges in expressing and purifying functional B. hyodysenteriae membrane proteins like mscL?

The expression and purification of B. hyodysenteriae membrane proteins present several challenges:

  • Toxicity to expression hosts: Overexpression of membrane proteins often leads to toxicity in E. coli, resulting in poor yields.

    • Solution: Use specialized strains like C41(DE3), lower expression temperatures, and tightly regulated promoters.

  • Protein misfolding and aggregation: Membrane proteins tend to aggregate when overexpressed.

    • Solution: Co-expression with chaperones, fusion with solubility-enhancing tags, and optimized induction protocols.

  • Extraction from membranes: Efficient solubilization without denaturation is critical.

    • Solution: Screen multiple detergents (DDM, LDAO, Triton X-100) at various concentrations to identify optimal solubilization conditions.

  • Maintaining native conformation: Detergent micelles may not fully mimic the lipid bilayer environment.

    • Solution: Consider reconstitution into nanodiscs, liposomes, or amphipols for functional studies.

  • Anaerobic culture requirements: B. hyodysenteriae is an anaerobic organism , which adds complexity to protein expression from native sources.

    • Solution: Heterologous expression in E. coli with codon optimization for the target protein.

How can researchers address difficulties in creating stable B. hyodysenteriae mutants for functional studies of mscL?

Creating stable mutants in B. hyodysenteriae presents specific challenges that can be addressed through several approaches:

  • Limited genetic tools:

    • Solution: Adapt genetic systems from related spirochetes, develop shuttle vectors with appropriate antibiotic resistance markers, and optimize electroporation protocols specifically for B. hyodysenteriae.

  • Low transformation efficiency:

    • Solution: Use VSH-1-mediated gene transfer, which has been demonstrated to work for transferring resistance genes between B. hyodysenteriae strains . Addition of mitomycin C can increase efficiency by inducing VSH-1 production.

  • Verification of gene disruption:

    • Solution: Use multiple approaches including PCR, Western blotting, and phenotypic assays to confirm successful mutation.

  • Genetic stability of mutants:

    • Solution: Regular verification of mutations through multiple passages and growth under various stress conditions.

  • Complementation for verification:

    • Solution: Develop complementation systems to restore wild-type phenotype, confirming that observed effects are due to the specific mutation.

What experimental controls are essential when studying recombinant B. hyodysenteriae mscL function?

When studying recombinant B. hyodysenteriae mscL function, several controls are essential:

  • Expression controls:

    • Empty vector controls to account for host cell responses to the expression system

    • Western blot verification of protein expression with appropriate antibodies

    • Expression of a well-characterized membrane protein like E. coli mscL as a positive control

  • Functional assays controls:

    • E. coli mscL knockout strain (negative control)

    • E. coli mscL knockout complemented with E. coli mscL (positive control)

    • Inactive mscL mutant (e.g., with mutation in the pore-lining region)

  • Specificity controls:

    • Channel blockers known to affect mechanosensitive channels

    • Varying lipid compositions to assess lipid-dependency of function

    • Osmotic conditions that should not activate the channel

  • In vivo relevance controls:

    • Comparison with native B. hyodysenteriae behavior under osmotic stress

    • Assessment of mscL expression levels during different growth phases and stress conditions

    • Correlation with virulence using clinical isolates with varying pathogenicity

How might high-throughput screening approaches be used to identify compounds that target B. hyodysenteriae mscL?

High-throughput screening (HTS) for compounds targeting B. hyodysenteriae mscL could employ several innovative approaches:

  • Fluorescence-based liposome assays:

    • Reconstitute mscL in liposomes containing self-quenching fluorescent dyes

    • Screen compounds that prevent dye release under hypoosmotic conditions (channel blockers)

    • Automate using microplate readers for thousands of compounds

  • Patch-clamp electrophysiology with planar arrays:

    • Utilize automated patch-clamp systems with multiple recording channels

    • Test compounds for alterations in channel conductance, gating kinetics, or tension sensitivity

  • Cell-based survival assays:

    • Express B. hyodysenteriae mscL in E. coli lacking endogenous mechanosensitive channels

    • Screen for compounds that increase susceptibility to osmotic downshock

  • Structure-based virtual screening:

    • Use homology models of B. hyodysenteriae mscL to virtually screen compound libraries

    • Prioritize compounds predicted to bind to functionally important regions

    • Validate hits using functional assays

  • Surface plasmon resonance screening:

    • Immobilize purified mscL and screen for direct binding of compounds

    • Determine binding kinetics and affinities for promising candidates

These approaches could lead to novel antimicrobial candidates specifically targeting B. hyodysenteriae.

What comparative genomic approaches could reveal the evolution and distribution of mscL variants across Brachyspira species?

Comparative genomic approaches for studying mscL evolution in Brachyspira species would include:

  • Whole genome sequencing analysis:

    • Sequence diverse isolates of B. hyodysenteriae and related species

    • Identify mscL homologs and analyze conservation patterns

    • Compare strongly and weakly β-hemolytic isolates to correlate mscL variants with virulence

  • Phylogenetic analysis:

    • Construct phylogenetic trees of mscL sequences across spirochetes

    • Compare with species trees to identify potential horizontal gene transfer events

    • Analyze selection pressure using dN/dS ratios to identify functionally important regions

  • Domain architecture analysis:

    • Compare transmembrane domain organization across species

    • Identify species-specific insertions or deletions that might affect function

    • Model structural consequences of sequence variations

  • Promoter region analysis:

    • Examine regulatory regions to understand expression differences

    • Identify potential stress-responsive elements

    • Compare with other mechanosensitive channel genes to reveal regulatory networks

  • Correlation with phenotypic properties:

    • Analyze strongly β-hemolytic isolates versus weakly β-hemolytic isolates

    • This is particularly relevant as phenotypic culture characteristics of Brachyspira may be more sensitive indicators of potential to induce dysentery-like disease than current molecular identification methods

How could CRISPR-Cas9 genome editing advance functional studies of B. hyodysenteriae mscL?

CRISPR-Cas9 genome editing could revolutionize B. hyodysenteriae mscL research through several applications:

  • Precise gene knockout studies:

    • Create clean deletions of the mscL gene without antibiotic resistance markers

    • Generate multiple knockouts of mechanosensitive channels to assess redundancy

    • Introduce specific point mutations to evaluate structure-function relationships

  • Regulatory element manipulation:

    • Modify promoter regions to alter expression levels

    • Create reporter fusions to monitor expression under different conditions

    • Engineer inducible systems for temporal control of mscL expression

  • Protein tagging for localization studies:

    • Introduce fluorescent protein fusions at the genomic level

    • Add epitope tags for immunoprecipitation and protein interaction studies

    • Create proximity labeling constructs to identify interaction partners

  • High-throughput functional genomics:

    • Create library of mscL variants with systematic mutations

    • Screen for effects on colonization, virulence, and stress response

    • Identify essential residues for channel function in the native context

  • Challenges and adaptations:

    • Optimize delivery methods for CRISPR components into B. hyodysenteriae

    • Engineer Cas9 variants with improved activity in this organism

    • Develop appropriate homology-directed repair templates

Implementation would require adaptation of CRISPR systems for the unique characteristics of B. hyodysenteriae, potentially leveraging VSH-1-mediated gene transfer mechanisms .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.