Recombinant Brachyteles hypoxanthus Cytochrome c oxidase subunit 2 (MT-CO2)

Shipped with Ice Packs
In Stock

Description

Genetic Diversity

Genetic diversity studies utilizing MT-CO2 sequences provide critical insights into the conservation of Brachyteles hypoxanthus . These studies often involve analyzing haplotype diversity (h) and nucleotide diversity (π) to understand the genetic structure of different populations .

  • Haplotype Diversity (h): Measures the uniqueness of haplotypes within a population .

  • Nucleotide Diversity (π): Measures the average number of nucleotide differences between any two DNA sequences in a population .

Research indicates that Brachyteles hypoxanthus has comparatively low mtDNA variation compared to other neotropical primates . For example, a study comparing the HVSI sequences of Alouatta caraya (howler monkey) to those of Brachyteles hypoxanthus found 31 haplotypes in A. caraya samples, whereas B. hypoxanthus showed lower nucleotide diversity .

Research Findings

Several studies have employed MT-CO2 to investigate the genetic diversity and population history of Brachyteles hypoxanthus . Key findings include:

  • Low Genetic Diversity: Brachyteles hypoxanthus exhibits low HVSI diversity compared to other threatened primates .

  • Population Structure: Genetic diversity is scattered across remnant populations, with some less-protected populations retaining significant variation .

  • Conservation Implications: Certain populations (PERD, PESB, RPPN-FMA, and SMJ) are identified as discrete management units due to their significant contribution to the species' genetic diversity .

2.1. Methods of Analysis

  1. Sequencing and Alignment:

    • Sequences are aligned using CLUSTAL W and inspected in BIOEDIT 7.0.5.3 .

    • A BLAST search confirms the absence of exogenous DNA contamination .

    • The B. hypoxanthus sequence from GenBank (AF213966) is used as a reference for alignment and haplotype determination .

  2. Software and Tools:

    • ARLEQUIN 3.01 is used for haplotype determination and population comparisons .

    • jMODELTEST is used to select the most appropriate nucleotide substitution model using the Akaike Information Criterion (AIC) .

    • DIYABC 1.0.4.38beta is used for Approximate Bayesian Computation (ABC) to test alternative scenarios for population diversification .

    • BEAST is employed to estimate parameters such as substitution rates using Bayesian methods .

    • LAMARC and MIGRATE-N 3.2.1 are used to estimate the mutation-scaled effective population size (θ) with coalescent-based methods .

2.2. Genetic Variability Estimates

Genetic variability is estimated using haplotype diversity (hh) and nucleotide diversity (π\pi) . The most appropriate model of nucleotide substitution is selected in jMODELTEST with the Akaike Information Criterion (HKY+I, base frequencies A = 0.3721, C = 0.2469, G = 0.1286, T = 0.2524, proportion of invariable sites of 0.9017, and transition/transversion ratio of 33) .

Conservation Implications

The genetic data obtained from MT-CO2 analysis has significant implications for the conservation management of Brachyteles hypoxanthus . Because population sizes are below accepted minimum viable population sizes, active management is required . Translocation of females between fragments is underway in some populations to reduce inbreeding effects .

Data Tables

Genetic diversity indices for Brachyteles hypoxanthus and other primate species:

SpeciesHaplotype Diversity (h)Nucleotide Diversity (π)
B. hypoxanthusLowVery Low
Alouatta carayaComparableLower

4.1. Management Units

Populations suggested as discrete management units :

  • PERD

  • PESB

  • RPPN-FMA

  • SMJ

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline for your preparations.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is defined during the production process. If you require a specific tag, please inform us for preferential development.
Synonyms
MT-CO2; COII; COXII; MTCO2; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-231
Protein Length
full length protein
Species
Brachyteles hypoxanthus (Northern muriqui) (Woolly spider monkey)
Target Names
Target Protein Sequence
MAHPVHVGLKEATSPFMEELIAFHDHTLMIIFLISSLVLYIISMMLTTKLTHTSTMNAQE IEIIWTILPAIILIMIALPSLRILYMTDEFNKPYLTLKAIGHQWYWSYEYSDYVDLAFDS YIMPTYFLEPGEFRLLEVDNRTTLPMEADIRMLISSQDVLHSWAVPSXGVKADAIPGRLN QAMLASMRPGLFYGQCSEICGSNHCFMPIVLEFSYFXDFETWASYLYIVSL
Uniprot No.

Target Background

Function
Cytochrome c oxidase subunit 2 (MT-CO2) is a component of cytochrome c oxidase (complex IV, CIV), the terminal enzyme in the mitochondrial electron transport chain. This enzyme is crucial for oxidative phosphorylation. The respiratory chain comprises three multi-subunit complexes: succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (complex III, CIII), and cytochrome c oxidase (complex IV, CIV). These complexes work cooperatively to transfer electrons from NADH and succinate to molecular oxygen, generating an electrochemical gradient across the inner mitochondrial membrane. This gradient drives transmembrane transport and ATP synthase activity. Cytochrome c oxidase catalyzes the reduction of oxygen to water. Electrons from reduced cytochrome c in the intermembrane space are transferred through the copper A center (CuA) of subunit 2 and heme A of subunit 1 to the active site in subunit 1, a binuclear center (BNC) comprising heme A3 and copper B (CuB). The BNC reduces molecular oxygen to two water molecules using four electrons from cytochrome c and four protons from the mitochondrial matrix.
Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.