Recombinant Bradyrhizobium japonicum ATP synthase subunit a (atpB)

Shipped with Ice Packs
In Stock

Description

Functional Role in B. japonicum Physiology

The atpB-encoded subunit a is essential for ATP synthase activity, which drives oxidative phosphorylation and supports survival under stress conditions:

  • Oxidative Stress Response: ATP synthase genes (including atpB) are downregulated during hydrogen peroxide (H₂O₂)-induced oxidative stress, suggesting metabolic reconfiguration to conserve energy .

  • Desiccation Tolerance: ATP synthase activity is linked to trehalose biosynthesis pathways, which protect B. japonicum during drought . Mutants lacking functional trehalose pathways show reduced nodulation efficiency in soybeans .

  • Symbiotic Nitrogen Fixation: ATP synthase provides energy for nitrogenase activity in bacteroids, critical for symbiotic nitrogen fixation in soybean root nodules .

Transcriptional Regulation Under Stress

Genome-wide studies reveal atpB’s differential expression under environmental stressors:

ConditionExpression TrendImplicationSource
Oxidative Stress (H₂O₂)Downregulated 7.5-foldEnergy conservation during ROS exposure
Indole-3-Acetic Acid (IAA)Downregulated 7.5-foldPhytohormone-induced metabolic suppression
Prolonged Paraquat ExposureUpregulated ATP synthaseEnhanced motility and stress tolerance

Technical Considerations for Use

  • Storage Stability: Repeated freeze-thaw cycles degrade the protein; aliquots stored at -80°C retain functionality .

  • Activity Assays: Requires reconstitution into lipid bilayers or proteoliposomes to study proton translocation .

  • Cross-Reactivity: Antibodies against His-tagged atpB show specificity in Western blotting .

Future Directions

Research gaps include elucidating post-translational modifications of recombinant atpB and its interaction with plant-derived metabolites during symbiosis. Comparative studies using mutant strains could further clarify its role in stress adaptation and host-specific nodulation .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to pellet the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline for your preparations.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
atpB; bll1188; ATP synthase subunit a; ATP synthase F0 sector subunit a; F-ATPase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-249
Protein Length
full length protein
Species
Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110)
Target Names
atpB
Target Protein Sequence
MKIDPIHQFNIEPLFTIGHIGHQTIAFTNSSLYMLIAVAIISLLMLASGAQLVPGRLQSV AEISYEFVASTIRSTAGSEGMKFFPLIFSLFMFICVSNLIGIIPYTFTISSHLIVTAALA LLVFFTVLIYGVAKNGLKFFSIFVPHGVPGYILPLVMFIEILSFFLRPVSHSVRLFANML AGHIALKVFAGFVAMLGFSLGALGWVGGVLPLALTVALYALEILVAFLQAYVFAILTCIY LNDAIHPGH
Uniprot No.

Target Background

Function
A key component of the proton channel, directly involved in proton translocation across the membrane.
Database Links

KEGG: bja:bll1188

STRING: 224911.bll1188

Protein Families
ATPase A chain family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Bradyrhizobium japonicum ATP synthase subunit a (atpB) and what is its role in cellular function?

ATP synthase subunit a (atpB) from Bradyrhizobium japonicum/diazoefficiens is a membrane protein component of the F0 sector of the ATP synthase complex. This 249-amino acid protein plays a critical role in proton translocation across membranes during ATP synthesis. As part of the ATP synthase complex, it contributes to the enzyme's primary function of generating ATP through oxidative phosphorylation .

The ATP synthase complex functions as a molecular motor that converts the energy derived from electrochemical gradients into ATP through phosphorylation of ADP . The a-subunit (atpB) specifically forms part of the proton channel, facilitating the movement of protons across the membrane, which drives the rotational mechanism necessary for ATP synthesis .

What are the optimal storage and handling conditions for recombinant atpB protein?

Based on manufacturer guidelines, the following storage and handling protocols are recommended for recombinant Bradyrhizobium japonicum atpB:

ParameterRecommendation
Long-term storage-20°C or -80°C
Working storage4°C for up to one week
Buffer compositionTris/PBS-based buffer, with 6-50% Trehalose or glycerol, pH 8.0
FormTypically provided as lyophilized powder
ReconstitutionReconstitute in deionized sterile water to 0.1-1.0 mg/mL
Critical precautionAvoid repeated freeze-thaw cycles

Prior to opening, it is recommended to briefly centrifuge the vial to bring contents to the bottom . For long-term storage after reconstitution, addition of 5-50% glycerol (final concentration) and aliquoting is advised to prevent degradation from repeated freeze-thaw cycles .

What expression systems are most effective for producing recombinant Bradyrhizobium japonicum atpB?

Escherichia coli is the predominant expression system used for recombinant Bradyrhizobium japonicum atpB protein . The recombinant protein is typically expressed with an N-terminal His-tag to facilitate purification through affinity chromatography.

For optimal expression, considerations should include:

  • Codon optimization for E. coli expression to address potential rare codon issues from Bradyrhizobium

  • Use of specialized E. coli strains designed for membrane protein expression

  • Controlled induction parameters to prevent formation of inclusion bodies

  • Optimization of growth temperature, typically lower temperatures (16-25°C) may improve folding of membrane proteins

  • Addition of specific detergents during extraction to maintain native conformation

The protein can be effectively purified to greater than 90% purity as determined by SDS-PAGE .

What functional assays can be used to verify the activity of recombinant atpB?

Several methodological approaches can be employed to assess the functional integrity of recombinant atpB:

  • Proton translocation assays: Reconstitution of atpB into proteoliposomes followed by measurement of proton flux using pH-sensitive fluorescent dyes.

  • Assembly verification: Analysis of proper incorporation into the complete ATP synthase complex through co-expression with other subunits, followed by blue native PAGE or size exclusion chromatography.

  • Structural integrity assessment: Circular dichroism or infrared spectroscopy to confirm proper secondary structure formation, particularly important for membrane proteins.

  • Interaction studies: Pull-down assays to verify binding to known interaction partners within the ATP synthase complex.

  • Complementation studies: Introduction of recombinant atpB into bacterial strains with defective endogenous atpB to assess functional restoration.

It is important to note that isolated atpB may have limited functional activity outside of the complete ATP synthase complex, so assembly studies may be more informative than direct activity measurements of the isolated subunit.

How does Bradyrhizobium japonicum atpB structure compare to ATP synthase a-subunits from other organisms?

ATP synthase is extraordinarily prevalent across all domains of life, with remarkable conservation in core functional components. The catalytic β-subunit exhibits more than 60% amino acid identity across bacteria, plants, and mammals . While the search results do not provide specific comparison data for the a-subunit (atpB), we can infer similar patterns of conservation in functionally critical regions.

Comparative structural analysis would likely reveal:

  • Conserved transmembrane domains critical for proton translocation

  • Preserved charged residues that form the proton path

  • Conserved interaction interfaces with the c-ring and other F0 subunits

  • Species-specific variations in non-critical regions

The protein's high degree of conservation reflects the fundamental importance of ATP synthase's rotary mechanism across all life forms, despite billions of years of evolutionary divergence .

What insights can site-directed mutagenesis of atpB provide about proton translocation mechanisms?

Site-directed mutagenesis studies of atpB can offer valuable insights into the precise mechanism of proton translocation and the coupling between proton movement and mechanical rotation. Strategic mutation targets include:

  • Charged residues in transmembrane regions: Mutations of arginine, lysine, glutamate, or aspartate residues likely involved in proton transfer can help map the proton pathway.

  • Residues at the a-c subunit interface: Modifications at this interface can elucidate how proton movement is converted to rotation of the c-ring.

  • Conserved motifs: Alteration of highly conserved sequence motifs can identify functionally critical regions.

  • Residues contributing to electric field properties: As noted in search results, the electric field within ATP synthase significantly enhances its enzymatic efficiency . Mutations affecting charge distribution could alter this electric field, providing insights into its role in promoting proton movement.

Combining mutagenesis with functional assays such as ATP synthesis measurements, proton pumping assays, and structural studies can establish structure-function relationships at the molecular level.

What role does atpB play in the formation of ATP synthase dimers and oligomers?

Recent research indicates that ATP synthase monomers tend to aggregate into dimers and ribbons of even-numbered oligomers in vivo . This oligomerization process has been shown to shape cristae membranes, potentially providing physiological benefits .

The a-subunit (atpB), as a membrane-embedded component of the F0 sector, likely plays a significant role in these higher-order interactions. Possible contributions include:

  • Formation of lateral interaction interfaces between adjacent ATP synthase complexes

  • Stabilization of curved membrane regions in the cristae

  • Creation of localized proton microdomains that enhance ATP synthesis efficiency

Oligomerization of ATP synthase enhances its activity and energy yield by establishing and preserving local proton charge and mitochondrial membrane potential . Future research using crosslinking studies, cryo-electron microscopy, and molecular dynamics simulations could further elucidate atpB's specific role in oligomer formation and stability.

How does prokaryotic atpB function differ from its eukaryotic counterparts?

While the core mechanism of ATP synthesis is conserved across prokaryotes and eukaryotes, several notable differences exist between Bradyrhizobium japonicum atpB and its eukaryotic counterparts:

  • Cellular location: In prokaryotes like Bradyrhizobium, ATP synthase is located in the plasma membrane, whereas in eukaryotes, it is primarily found in the inner mitochondrial membrane or chloroplast thylakoid membrane .

  • Structural complexity: Eukaryotic ATP synthases typically contain additional subunits not found in prokaryotic versions, which may provide regulatory functions or structural stability.

  • Energy coupling: Prokaryotic ATP synthases may operate under different proton motive force conditions, reflecting adaptation to various environmental niches.

  • Inhibitor sensitivity: Prokaryotic and eukaryotic ATP synthases often display differential sensitivities to inhibitors, which has implications for antibiotic development .

  • Regulation: Regulatory mechanisms controlling ATP synthase activity differ between prokaryotes and eukaryotes, reflecting their different metabolic needs and cellular organization.

Understanding these differences has implications for both basic research and applied fields such as antibiotic development.

What is the significance of atpB in nitrogen-fixing bacteria like Bradyrhizobium japonicum?

In nitrogen-fixing bacteria like Bradyrhizobium japonicum, ATP synthase plays a particularly critical role due to the high energy demands of the nitrogen fixation process. Some specific considerations include:

  • Energy supply for nitrogenase: The conversion of atmospheric nitrogen (N₂) to ammonia by nitrogenase requires substantial ATP input, making efficient ATP synthesis crucial for symbiotic nitrogen fixation.

  • Adaptation to microaerobic conditions: Nitrogen fixation occurs under low oxygen conditions in root nodules, which may necessitate specific adaptations in ATP synthase to function optimally in this environment.

  • pH adaptation: Bradyrhizobium must adapt to varying pH conditions in soil and within the plant-derived symbiosome, potentially requiring specific properties in atpB for proton handling.

  • Metabolic flexibility: ATP synthase may operate differently depending on whether Bradyrhizobium is in its free-living soil state or symbiotic nodule state.

These aspects make atpB an interesting target for understanding energy metabolism in the context of symbiotic relationships and may provide insights relevant to agricultural applications.

How might research on Bradyrhizobium japonicum atpB contribute to our understanding of bacterial bioenergetics?

Future research on Bradyrhizobium japonicum atpB could significantly advance our understanding of bacterial bioenergetics in several key areas:

  • Adaptation to environmental stress: Investigating how atpB structure and function respond to environmental stressors (pH, temperature, oxygen limitation) could reveal adaptation mechanisms relevant to soil bacteria.

  • Energy conservation strategies: Studies on the efficiency of ATP synthesis in Bradyrhizobium could uncover novel energy conservation mechanisms relevant to bacteria living in nutrient-limited environments.

  • Role in symbiosis: Exploring how ATP synthase activity is regulated during the establishment and maintenance of symbiotic relationships could provide insights into the energetics of mutualistic interactions.

  • Comparative studies: Analysis of atpB across different Bradyrhizobium strains with varying host specificities or nitrogen fixation efficiencies could reveal correlations between energy metabolism and symbiotic effectiveness.

  • Structural biology: High-resolution structural studies of Bradyrhizobium japonicum ATP synthase could contribute to our general understanding of this molecular machine's operation.

What potential applications might emerge from studying recombinant Bradyrhizobium japonicum atpB?

Research on recombinant Bradyrhizobium japonicum atpB could lead to several practical applications:

  • Agricultural improvements: Understanding energy metabolism in nitrogen-fixing bacteria could lead to strategies for enhancing symbiotic nitrogen fixation, reducing the need for chemical fertilizers.

  • Antimicrobial development: Differences between bacterial and human ATP synthases could be exploited for developing targeted antimicrobials with minimal side effects .

  • Biotechnology applications: Insights into ATP synthase mechanism could inform the development of artificial molecular motors or energy-harvesting devices.

  • Structural biology tools: Well-characterized recombinant proteins can serve as standards for developing new structural biology methods or membrane protein research techniques.

  • Environmental applications: Understanding energy metabolism in soil bacteria could contribute to bioremediation strategies or soil health assessment methods.

What are common challenges in working with recombinant atpB and how can they be addressed?

Working with membrane proteins like atpB presents several technical challenges:

ChallengeSolution Approach
Poor expression yieldOptimize codon usage, expression temperature, and induction conditions; consider specialized expression hosts
Protein aggregationUse mild detergents for extraction; optimize buffer conditions; consider fusion partners that enhance solubility
Loss of native conformationMaintain appropriate detergent concentrations throughout purification; consider lipid addition to stabilize structure
Degradation during purificationInclude protease inhibitors; minimize purification time; maintain cold temperatures throughout
Difficulty in functional assessmentReconstitute with other ATP synthase subunits; establish sensitive detection methods for proton translocation

Additionally, researchers should be aware that repeated freeze-thaw cycles can significantly reduce protein quality and activity . Proper aliquoting and storage at recommended temperatures are essential for maintaining protein integrity.

What reconstitution methods are most effective for functional studies of recombinant atpB?

For functional studies of membrane proteins like atpB, effective reconstitution into membrane mimetic systems is crucial. Recommended approaches include:

  • Proteoliposome preparation:

    • Selection of appropriate lipid composition that mimics the native membrane environment

    • Controlled detergent removal using dialysis, bio-beads, or cyclodextrin

    • Verification of proper orientation (inside-out vs. right-side-out vesicles)

    • Quality control via freeze-fracture electron microscopy or dynamic light scattering

  • Co-reconstitution with partner proteins:

    • Simultaneous incorporation of other F0 subunits for more complete functional studies

    • Controlled protein:lipid ratios to achieve physiologically relevant densities

    • Stepwise assembly of the complex to ensure proper interactions

  • Alternative membrane mimetics:

    • Nanodiscs for single-molecule studies and structural analysis

    • Polymer-based systems like amphipols for enhanced stability

    • Lipid cubic phases for crystallization attempts

Successful reconstitution should be verified through both structural (e.g., electron microscopy) and functional (e.g., proton translocation) assays before proceeding to detailed mechanistic studies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.