Recombinant Bradyrhizobium japonicum ATP synthase subunit b/b' (atpG)
Shipped with Ice Packs 
In Stock 
Product Specs
Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, offered as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C; lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If a specific tag type is required, please inform us, and we will prioritize its development.
The tag type is determined during the production process. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
atpF2; atpG; bll1186; ATP synthase subunit b 2; ATP synthase F(0 sector subunit b 2; ATPase subunit I 2; F-type ATPase subunit b 2; F-ATPase subunit b 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-187
Protein Length
full length protein
Species
Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110)
Target Names
atpF2
Target Protein Sequence
MAESHGGAKGPAAGAHTGAEGGHGGGFPPFESSTYASQLVSLAIFFVVLYVIVSKLALPK
VGGAIEARQNKIEGDLAEAQTLRDQSDAALKAYESELASARSRAQAIGNESRDKANAQAE
TERKALEEQLAAKLAGAEKTIASTRTAAMSNVRGIAADAAGQIVQQLTGVVPDAASVNAA
VDASLKG
Uniprot No.
Target Background
Function
F1F0 ATP synthase synthesizes ATP from ADP using a proton or sodium gradient. This enzyme comprises two domains: the extramembranous catalytic F1 domain and the membrane-bound proton channel F0 domain, connected by a central and peripheral stalk. ATP synthesis in the F1 catalytic domain is coupled to proton translocation through a rotary mechanism involving the central stalk subunits. The b' subunit is a divergent, duplicated form of the b subunit, found in plants and photosynthetic bacteria, forming part of the peripheral stalk, linking F1 and F0.
Database Links
KEGG: bja:bll1186
STRING: 224911.bll1186
Protein Families
ATPase B chain family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
