Recombinant Bradyrhizobium japonicum Beta- (1-->2)glucan export ATP-binding/permease protein NdvA (ndvA)

Shipped with Ice Packs
In Stock

Description

Introduction and Molecular Context

Bradyrhizobium japonicum, a gram-negative soil bacterium, forms nitrogen-fixing nodules on soybean roots, establishing a mutually beneficial relationship critical for agricultural sustainability. The successful establishment of this symbiosis depends partly on the production and export of cyclic beta-(1-->2)glucans, which function in adaptation to osmotic environments and as signaling molecules during plant-microbe interactions .

The ndvA gene product in B. japonicum shares significant homology with the NdvA protein of Rhizobium meliloti, which has been extensively characterized as essential for beta-(1-->2)glucan production . In R. meliloti, mutations in the ndvA gene result in defective production of cyclic extracellular polysaccharide beta-(1-->2)glucan, even though the intermediate proteins involved in glucan synthesis remain active . This finding suggests that NdvA specifically functions in the export rather than synthesis of these molecules.

The importance of this transport system extends beyond simple cellular functions. Studies in related bacteria demonstrate that proper beta-glucan export is fundamentally important for normal nodule development on host plants . Understanding the structure and function of NdvA therefore provides valuable insights into the molecular basis of plant-microbe symbiosis and potential applications in agricultural biotechnology.

Protein Architecture

The NdvA protein belongs to the ATP-binding cassette (ABC) transporter superfamily, characterized by specific nucleotide-binding domains and transmembrane segments. Based on sequence analysis and homology studies with related proteins, particularly R. meliloti NdvA, the B. japonicum NdvA is predicted to be a 67.1 kDa protein with multiple transmembrane domains .

The protein contains a large open reading frame encoding a polypeptide that exhibits significant homology to various bacterial ATP-binding transport proteins . The most notable homology exists with Escherichia coli HlyB, a protein involved in hemolysin export, suggesting evolutionary conservation of transport mechanisms across bacterial species .

Functional Domains and Motifs

The functional architecture of NdvA includes distinct domains essential for its transport activity:

  1. ATP-binding domains containing Walker A and Walker B motifs, which bind and hydrolyze ATP to power substrate translocation

  2. Multiple transmembrane domains that form the channel through which beta-(1-->2)glucans are transported

  3. Substrate-binding regions that specifically recognize cyclic beta-glucans

This arrangement of domains enables NdvA to couple energy from ATP hydrolysis with the conformational changes necessary for unidirectional transport of beta-(1-->2)glucans across the bacterial membrane .

The ndvA Locus

The ndvA gene in B. japonicum is part of a complex genetic system involved in beta-glucan synthesis and export. While detailed information on B. japonicum ndvA gene organization is limited in available literature, insights can be gained from related systems. In R. meliloti, the ndvA locus is homologous to and can functionally substitute for the chvA locus of Agrobacterium tumefaciens, indicating conservation of this export system across different plant-associated bacteria .

Related Genetic Components

The beta-glucan synthesis and export system in B. japonicum also includes other genes such as ndvB and ndvC . Site-directed Tn5 mutagenesis studies have identified ndvC as involved in beta-(1-->3), beta-(1-->6)-glucan synthesis and nodule development . The ndvC gene product is a polypeptide of approximately 62 kDa with several transmembrane domains and contains a conserved nucleoside-sugar-binding motif characteristic of many bacterial enzymes .

Table 1: Key Genes Involved in Beta-Glucan Synthesis and Export in Bradyrhizobium japonicum

GeneProtein SizeMain FunctionEffect of MutationHomology
ndvA~67.1 kDaBeta-(1-->2)glucan exportDefective export of beta-glucansHomologous to E. coli HlyB and mammalian mdr gene product
ndvBNot specifiedBeta-glucan synthesisSevere sensitivity to hypoosmotic conditions Not specified in available data
ndvC~62 kDaBeta-(1-->3), beta-(1-->6)-glucan synthesisAltered glucan composition, delayed nodulation 51% similarity with beta-glucanosyltransferase from Candida albicans

ABC Transporter Mechanism

As an ATP-binding cassette (ABC) transporter, NdvA functions through a general mechanism that couples ATP hydrolysis with substrate translocation. This process typically involves several steps:

  1. Binding of ATP to the nucleotide-binding domains

  2. Substrate recognition and binding

  3. ATP hydrolysis driving conformational changes

  4. Substrate translocation across the membrane

  5. Release of substrate and restoration of the initial state

The multidrug resistance ABC transporters, which share structural similarities with NdvA, translocate hydrophobic molecules by coupling this efflux with energy derived from ATP hydrolysis . The conformational changes induced by ATP binding and hydrolysis are critical for creating the mechanical force needed to move substrates across the membrane barrier.

Substrate Specificity

The NdvA protein demonstrates high specificity for beta-(1-->2)glucans, ensuring selective export of these molecules. This specificity likely arises from particular structural features within the transmembrane domains that recognize the unique three-dimensional conformation of cyclic beta-glucans. The specific mechanism of substrate recognition remains an area requiring further research.

Impact on Nodulation

The NdvA-mediated export of beta-glucans plays a critical role in the establishment of successful symbiotic relationships between B. japonicum and host plants. Evidence for this comes from studies of related systems and beta-glucan synthesis mutants in B. japonicum.

B. japonicum strains with mutations affecting beta-glucan synthesis exhibit significant impairments in symbiotic interactions. For example, ndvC mutants show delayed nodulation by 8-10 days and form many small nodule-like structures that appear devoid of viable bacteria . This suggests that the proper structure of beta-glucans is important for successful symbiotic interactions, beyond their role in hypoosmotic adaptation .

Molecular Signaling

Beta-glucans exported by NdvA may function as signaling molecules during the complex dialogue between bacteria and plants in the nodulation process. These molecules potentially suppress plant defense responses, allow bacterial infection thread formation, or provide osmotic adjustment during transition from soil to plant environments.

Table 2: Effects of Beta-Glucan Export Deficiency on Symbiotic Phenotypes

OrganismMutationEffect on Beta-GlucanEffect on NodulationOther Phenotypes
R. melilotindvADefective in extracellular beta-(1-->2)glucan productionForms small, white, empty nodules Reduced motility
B. japonicumndvCAltered beta-glucans (primarily beta-(1-->3)-glycosyl linkages) Delayed nodulation, ineffective nodules Slightly sensitive to hypoosmotic conditions
A. tumefacienschvADefective in beta-(1-->2)glucan productionNot applicable (pathogen)Reduced virulence

Expression Systems

The recombinant production of NdvA presents significant challenges due to its nature as a membrane protein and the slow growth characteristics of B. japonicum. Traditional approaches for recombinant protein expression often require modifications when applied to membrane proteins like NdvA.

One approach to studying recombinant proteins in B. japonicum involves the development of rapid selection methods for site-directed mutants. This technique uses antibiotic cassettes (kanamycin or spectinomycin) to replace DNA fragments in the chromosome through homologous recombination, followed by simple plate selection and colony screening . This method has allowed researchers to quickly identify positive recombinant mutants from large numbers of individual colonies without the need to isolate genomic DNA from each mutant for Southern hybridization .

Purification and Characterization Challenges

The purification of recombinant NdvA typically requires specialized techniques due to its membrane-embedded nature. Common approaches include:

  1. Detergent-based extraction from membranes

  2. Affinity chromatography using engineered tags

  3. Size exclusion chromatography for final purification

Functional characterization of purified NdvA can be achieved through various methods:

  1. ATPase activity assays to measure ATP hydrolysis rates

  2. Transport assays using radiolabeled or fluorescently labeled substrates

  3. Structural analysis through techniques such as cryo-electron microscopy

Table 3: Methods for Recombinant Protein Production in Bradyrhizobium japonicum

MethodPrincipleAdvantagesLimitationsReferences
Antibiotic cassette replacementHomologous recombination with Km or Sp resistance genesRapid identification of recombinantsHigh spontaneous antibiotic resistance in B. japonicum
Colony hybridizationDirect identification through DNA hybridization on nitrocellulose filtersEliminates need for genomic DNA isolationRequires careful optimization of lysis conditions
Site-directed Tn5 mutagenesisTransposon insertion at specific sitesAllows identification of gene functionMay have polar effects on downstream genes

Functional Conservation

The functional importance of beta-glucan export is demonstrated by the conservation of similar systems across various plant-associated bacteria. The ndvA locus of R. meliloti can substitute for the chvA locus of A. tumefaciens, highlighting the functional equivalence of these export systems despite differences in the bacterial species .

The conservation of these export mechanisms suggests their fundamental importance in bacterial adaptation and plant-microbe interactions. Multidrug resistance ABC transporters, which share structural similarities with NdvA, couple drug/lipid efflux with energy derived from ATP hydrolysis in a comparable mechanism .

Knowledge Gaps

Despite advances in understanding NdvA, several knowledge gaps remain:

  1. Detailed structural information: High-resolution structures of NdvA would provide insights into the precise mechanism of substrate recognition and transport.

  2. Regulatory networks: The factors controlling ndvA expression under different environmental conditions and during symbiotic interactions require further investigation.

  3. Specific roles in signaling: The exact functions of exported beta-glucans in plant-microbe communication pathways need clarification.

Potential Applications

The study of NdvA and related proteins presents several promising applications:

  1. Agricultural enhancements: Engineering bacteria with optimized beta-glucan export capabilities might improve nodulation efficiency and nitrogen fixation in leguminous crops.

  2. Biotechnological tools: NdvA could potentially be utilized in engineered biosynthetic pathways for the production of modified beta-glucans with pharmaceutical or industrial applications.

  3. Development of inhibitors: Compounds targeting NdvA function could serve as research tools or potentially as agricultural agents to modulate specific plant-microbe interactions.

Recombinant NdvA expression systems could also be valuable for producing and studying membrane proteins from slow-growing bacteria like B. japonicum, offering broader applications in protein biochemistry and structural biology.

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format that is currently in stock. However, if you have specific requirements for the format, please indicate them in your order notes. We will prepare the product according to your request.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery estimates.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
The shelf life depends on various factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize its inclusion in the development process.
Synonyms
ndvA; bll1321; Beta-(1-->2glucan export ATP-binding/permease protein NdvA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-602
Protein Length
full length protein
Species
Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110)
Target Names
ndvA
Target Protein Sequence
MSIFSLYTRVLELLGKEARLGWLLAFANLLLAASQFAEPVLFGRIVDVLSGKSVAGSSSA WPFLAAWVAFGLFTIACSALVALQADRLSHRQRQAVLTDYFEHILQLPLTFHSGTHSGRL MKVMLNGTDALWRLWLGFFREHFAAILSVVVLLPLSLYLNWRLAILLFVLCIVFTALTTF VVRRTFGMQMAVEEHYSELSARASDALGNVALVQSFVRVESEVQGLRSVANQLLEAQMPV LSWWALVTVITRASTTITVLAIFTLGIALHDQGLTSVGEIVMFVSFATLLIQKLEQVVSF INNVFMEAPRLREFFNVLDAVPAVHDRPDAIDAGRLSGLVEFNDVTFSYDGKRPAVEDLS FTALPGQTVALVGPTGAGKSTAIALLHRAFDPQSGFIRIDGMDVRGVTLTSLRRNIGVVF QEALLFNRSIAENLRVGKPDATEAEMRKAAERAQALEFIERSGGFETNAGERGRMLSGGE RQRLSIARALLKDPPILILDEATSALDAVTEVKVNAALDEVMRGRTTFVIAHRLATIRNA TRILVFENGRVTESGTFDELVAKGGHFAELARAQFMVQEQSRANTRASVTAAETIATAAK SP
Uniprot No.

Target Background

Function
This protein is involved in beta-(1-->2)glucan export. The transmembrane domains (TMD) form a pore in the inner membrane, while the ATP-binding domain (NBD) is responsible for energy generation.
Database Links

KEGG: bja:bll1321

STRING: 224911.bll1321

Protein Families
ABC transporter superfamily, Beta-(1-->2)glucan exporter (TC 3.A.1.108.1) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the NdvA protein in Bradyrhizobium japonicum and how does it relate to nodulation?

The NdvA protein in Bradyrhizobium japonicum is a bacterial ATP-binding transport protein that functions in the export of beta-(1-->2)glucan from the bacterial cell. While initially characterized in Rhizobium meliloti, homologous proteins exist across rhizobial species. NdvA is fundamentally important for normal nodule development during symbiotic interactions with leguminous plants. The protein has a molecular weight of approximately 67,100 daltons and belongs to a family of ATP-binding transport proteins involved in molecular export mechanisms .

The export of beta-(1-->2)glucan facilitated by NdvA is critical for successful symbiotic relationships, as ndvA mutants exhibit impaired nodulation capabilities. These mutants typically form small, white, empty nodules that fail to establish proper nitrogen-fixing symbiosis with host plants . This indicates that the proper export of beta-(1-->2)glucan is essential for the developmental process of nodule formation.

How does NdvA function in the context of bacterial-plant symbiosis?

NdvA functions within a complex signaling network that facilitates intercellular communication between bacteria and leguminous plants. In the symbiotic relationship between rhizobia and legumes, bacterial gene expression is carefully regulated in response to plant-produced signals . The NdvA protein specifically enables the export of cyclic extracellular polysaccharide beta-(1-->2)glucan, which appears to be necessary for proper nodule development .

The symbiotic process begins with the exchange of chemical signals between the plant and bacteria. Plant-produced flavones and isoflavones (such as genistein and daidzein in the case of B. japonicum) induce the expression of bacterial nodulation genes . While NdvA is not directly involved in the initial signaling process mediated by Nod factors, its role in exporting beta-(1-->2)glucan is crucial for subsequent steps in nodule formation and development.

What homology exists between NdvA and other bacterial transport proteins?

NdvA exhibits significant homology with several bacterial ATP-binding transport proteins, particularly those involved in molecular export. The greatest sequence similarity is observed with Escherichia coli HlyB, a protein responsible for the export of hemolysin . This homology suggests conserved functional mechanisms across different bacterial export systems.

Additionally, NdvA shows homology with the mammalian mdr gene product, which is also thought to be involved in molecular export functions . The conservation of structural and functional domains across these proteins indicates evolutionary relationships and potentially shared mechanisms of action. The ATP-binding domains particularly show high degrees of conservation, reflecting the fundamental importance of ATP hydrolysis in driving the export process.

How is ndvA gene expression regulated in response to environmental cues?

The regulation of ndvA gene expression involves complex interactions between bacterial regulatory proteins and plant-derived signal molecules. While the search results don't provide explicit details about ndvA regulation, we can infer from related rhizobial regulatory systems that ndvA likely responds to environmental cues that signal the presence of a compatible host plant.

In B. japonicum, nodulation genes are regulated by NodD proteins, which function as transcriptional regulators. NodD1 acts as a positive transcriptional activator that responds to plant-produced isoflavones (genistein and daidzein), while NodD2 functions as a repressor of nod gene expression . Given the importance of ndvA in symbiosis, its expression may be coordinated with other symbiotic genes through similar regulatory mechanisms, though the specific pathways require further investigation.

What is the relationship between nodulation genes and ndvA?

Although the direct regulatory relationship between nodulation genes and ndvA is not explicitly described in the search results, we can extrapolate from functional relationships. The nodABC genes in B. japonicum are essential for the synthesis of Nod factors (chitooligosaccharides), which initiate the symbiotic process by triggering plant responses . These genes are induced by plant-produced flavones and isoflavones through the action of NodD proteins .

The ndvA gene product, meanwhile, is involved in exporting beta-(1-->2)glucan, which is necessary for later stages of nodule development . This suggests a sequential relationship wherein nodulation genes are activated early in the symbiotic process to produce signaling molecules, while ndvA facilitates the production of extracellular polysaccharides needed for successful nodule formation and development. The temporal coordination of these processes is likely mediated by complex regulatory networks responding to both plant signals and developmental cues.

What methods are effective for creating and characterizing ndvA mutants?

Creating ndvA mutants in Bradyrhizobium japonicum typically involves molecular cloning techniques and homologous recombination. Based on the methodologies described for related genes, the following approach would be effective:

  • Clone Construction: Isolate the ndvA gene region from B. japonicum using PCR amplification with specific primers designed based on the known sequence. Clone this fragment into an appropriate vector such as those described for nodulation gene studies .

  • Mutagenesis Strategy: Introduce mutations through insertion of antibiotic resistance markers (e.g., kanamycin resistance) or through deletion of portions of the gene. This can be accomplished using restriction enzyme digestion and ligation methods .

  • Transformation: Transfer the mutated construct into B. japonicum cells using electroporation or conjugation with helper strains.

  • Selection: Identify transformed cells using selective media containing appropriate antibiotics.

  • Verification: Confirm the mutation through PCR analysis, Southern blotting, and DNA sequencing to ensure the desired genetic modification has occurred .

  • Phenotypic Characterization: Assess the mutants for changes in beta-(1-->2)glucan production, export capacity, and symbiotic capabilities with host plants .

How can beta-(1-->2)glucan export be quantitatively measured?

Several methodological approaches can be employed to quantitatively measure beta-(1-->2)glucan export in wild-type and ndvA mutant strains:

  • Biochemical Extraction and Quantification:

    • Extract extracellular and cell-associated beta-(1-->2)glucan using established protocols

    • Quantify using colorimetric assays such as anthrone reagent methods

    • Compare amounts in culture supernatants versus cell pellets to determine export efficiency

  • Radioactive Labeling:

    • Grow bacteria in media containing 14C-labeled glucose

    • Monitor incorporation into beta-(1-->2)glucan and subsequent export

    • Separate cellular and extracellular fractions and measure radioactivity

  • Immunological Detection:

    • Develop antibodies specific to beta-(1-->2)glucan

    • Use ELISA or Western blotting to quantify levels in different cellular compartments

    • This approach can distinguish between cell-associated and exported glucan

  • In vitro Transport Assays:

    • Prepare membrane vesicles containing NdvA protein

    • Measure ATP-dependent transport of labeled beta-(1-->2)glucan precursors

    • Compare transport rates between wild-type and mutant proteins

How do ndvA mutations affect symbiotic capabilities with different leguminous hosts?

Mutations in the ndvA gene significantly impact symbiotic capabilities with leguminous host plants. In Rhizobium meliloti, ndvA mutants form small, white, empty nodules on alfalfa roots, indicating a failure to establish functional nitrogen-fixing symbiosis . These mutants also exhibit reduced motility, which may affect their ability to effectively colonize root surfaces.

For B. japonicum, we can infer similar effects on symbiosis with soybean plants, although specific studies on B. japonicum ndvA mutants are not detailed in the search results. The following phenotypic changes would be expected in plants inoculated with ndvA mutants:

  • Formation of underdeveloped, non-functional nodules

  • Reduced nitrogen fixation capacity

  • Impaired plant growth and development due to nitrogen deficiency

  • Possible alterations in root architecture and nodule distribution

What is the role of NdvA in bacterial adaptation to environmental stresses?

While the search results don't specifically address NdvA's role in stress adaptation, the export of beta-(1-->2)glucan likely contributes to bacterial resilience under various environmental conditions. Based on known functions of similar extracellular polysaccharides in other bacteria, potential roles include:

  • Osmotic Stress Protection: Beta-(1-->2)glucan may help maintain cellular osmotic balance under fluctuating soil moisture conditions.

  • pH Buffering: The exported polysaccharide could create a microenvironment that buffers against pH changes in the rhizosphere.

  • Biofilm Formation: Beta-(1-->2)glucan may contribute to biofilm development, which protects bacterial communities from environmental stresses and antimicrobial compounds.

  • Root Colonization Efficiency: The polysaccharide might enhance attachment to root surfaces, improving competitive ability in the rhizosphere, as suggested by field trial objectives for enhanced root-nodulation .

Experimental approaches to investigate these functions would include exposing wild-type and ndvA mutant strains to various stressors (drought, pH extremes, temperature fluctuations, competing microorganisms) and measuring survival rates, competitive fitness, and beta-(1-->2)glucan production under these conditions.

How conserved is the ndvA gene across rhizobial species and what does this suggest about its evolutionary importance?

The ndvA gene shows significant conservation across rhizobial species, suggesting strong evolutionary pressure to maintain this function. The ndvA locus of Rhizobium meliloti is homologous to and can functionally substitute for the chvA locus of Agrobacterium tumefaciens , indicating conservation of both sequence and function across different genera of the Rhizobiaceae family.

The high degree of conservation of ndvA across species that engage in symbiotic relationships with different host plants suggests that beta-(1-->2)glucan export is a fundamental requirement for successful plant-microbe interactions rather than a host-specific adaptation. This evolutionary conservation indicates that the mechanism emerged early in the evolution of rhizobial-legume symbiosis and has been maintained due to its essential function.

What functional homologs of NdvA exist in other bacterial genera and what can they reveal about transport mechanisms?

NdvA belongs to a family of ATP-binding transport proteins with homologs across various bacterial genera. Key functional homologs include:

  • HlyB in Escherichia coli: Involved in the export of hemolysin, this protein shows the greatest degree of relatedness to NdvA . The functional similarity suggests conserved mechanisms for ATP-dependent molecular transport across diverse bacterial species.

  • ChvA in Agrobacterium tumefaciens: The ndvA locus is homologous to and can substitute for the chvA locus , indicating functional conservation in the export of similar polysaccharides.

  • MDR-like proteins: NdvA shows homology to the mdr gene product of mammalian cells, which is also thought to be involved in molecular export . This broader evolutionary relationship extends beyond bacteria to eukaryotic transport systems.

Comparative analysis of these homologs reveals insights about transport mechanisms:

ProteinOrganismSubstrateATP-binding DomainKey Functional Features
NdvARhizobium/BradyrhizobiumBeta-(1-->2)glucanPresentRequired for symbiotic nodulation
HlyBE. coliHemolysinPresentVirulence factor export
ChvAA. tumefaciensSimilar polysaccharidesPresentPlant interaction/pathogenesis
MDRMammalian cellsVarious moleculesPresentMultidrug resistance

This evolutionary conservation of transport mechanisms across diverse bacterial species and even across kingdoms suggests fundamental importance of ATP-dependent export systems in cellular function and microbe-host interactions.

How can recombinant NdvA be engineered to enhance nodulation efficiency in agricultural settings?

Engineering recombinant NdvA to enhance nodulation efficiency represents an advanced application with potential agricultural benefits. Based on the regulatory and functional information available, several approaches could be explored:

  • Promoter Modification: The natural regulation of ndvA could be modified by replacing its native promoter with one that responds more strongly to plant signals or is constitutively active. This approach might enhance beta-(1-->2)glucan export and potentially improve nodulation efficiency .

  • Protein Engineering: Strategic modifications to the NdvA protein sequence could enhance its ATP-binding efficiency or substrate specificity. For example, mutations in the ATP-binding domain might increase the rate of beta-(1-->2)glucan export.

  • Co-expression Strategies: Engineering B. japonicum strains to co-express optimized ndvA along with enhanced nodABC genes could create synergistic effects on nodulation. The DNA sequences of the nodABC gene transcript could potentially be fused to ndvA resulting in coordinated expression in response to plant-produced chemicals .

  • Field Testing Approaches: Testing engineered strains requires carefully designed field trials similar to those described for the mutant strain Bj 61A273KS, which was evaluated for competitive ability to enhance root-nodulation, improve nitrogen fixing capability, and enhance yield in soybean plants .

What is the molecular mechanism of ATP hydrolysis coupling to beta-(1-->2)glucan transport?

Understanding the molecular mechanism of ATP hydrolysis coupling to beta-(1-->2)glucan transport by NdvA represents an advanced research question. While the search results don't provide specific details about this mechanism, we can propose a model based on homologous ATP-binding transport proteins:

  • ATP Binding and Hydrolysis Cycle:

    • ATP likely binds to the conserved ATP-binding domain of NdvA

    • Binding induces conformational changes in the protein

    • ATP hydrolysis to ADP releases energy that drives substrate transport

    • ADP release resets the protein for another transport cycle

  • Coupling Mechanism: The energy from ATP hydrolysis probably induces conformational changes in the transmembrane domains of NdvA, creating a pathway for beta-(1-->2)glucan to move across the membrane.

  • Substrate Recognition: Specific domains within NdvA likely recognize beta-(1-->2)glucan or its precursors, ensuring selective transport of the correct molecules.

  • Regulatory Interactions: As part of a larger export complex, NdvA likely interacts with the 235,000-dalton membrane intermediate involved in beta-(1-->2)glucan synthesis. These interactions coordinate synthesis with export .

Experimental approaches to investigate this mechanism would include site-directed mutagenesis of conserved residues in the ATP-binding domain, ATPase activity assays, and structural studies using techniques such as X-ray crystallography or cryo-electron microscopy.

What emerging technologies could advance our understanding of NdvA function?

Several emerging technologies could significantly advance our understanding of NdvA function and beta-(1-->2)glucan export mechanisms:

  • CRISPR-Cas9 Gene Editing: This technology allows for precise modifications to the ndvA gene, enabling the creation of tailored mutations to investigate specific functional domains. Researchers could create libraries of ndvA variants with mutations in different regions to systematically map structure-function relationships.

  • Single-Molecule Imaging Techniques: Advanced fluorescence microscopy approaches could visualize individual NdvA proteins during the transport process, providing insights into real-time dynamics of beta-(1-->2)glucan export.

  • Cryo-Electron Microscopy: This technique could reveal the three-dimensional structure of NdvA at near-atomic resolution, particularly in different conformational states during the transport cycle.

  • AlphaFold and Other AI Prediction Tools: AI-based protein structure prediction tools could model NdvA structure and predict functional domains, guiding experimental design.

  • Metabolic Flux Analysis: Advanced techniques to track carbon flow through the beta-(1-->2)glucan synthesis and export pathway could reveal rate-limiting steps and regulatory points.

  • Synthetic Biology Approaches: Reconstituting the entire beta-(1-->2)glucan synthesis and export system in heterologous hosts could allow for detailed mechanistic studies in controlled environments.

How might understanding NdvA function contribute to developing more effective biofertilizers?

Understanding NdvA function has significant implications for developing enhanced biofertilizers based on rhizobial strains:

  • Optimized Symbiotic Efficiency: Engineering strains with optimized ndvA expression could potentially enhance nodulation efficiency and nitrogen fixation capacity, leading to improved plant growth with reduced need for chemical fertilizers.

  • Extended Host Range: Modifications to NdvA and related export systems might allow rhizobial strains to form effective symbiotic relationships with a broader range of leguminous crops, expanding the application of biological nitrogen fixation.

  • Environmental Resilience: Understanding how NdvA contributes to stress adaptation could lead to the development of rhizobial strains with enhanced survival under adverse field conditions such as drought, salinity, or acidic soils.

  • Synergistic Formulations: Knowledge of beta-(1-->2)glucan export mechanisms could inform the development of biofertilizer formulations that include complementary components to enhance rhizobial performance.

  • Quality Control Markers: The ndvA gene and its expression levels could serve as molecular markers for quality control in biofertilizer production, ensuring that commercial products contain strains with optimal symbiotic potential.

Field testing approaches similar to those described for the mutant strain Bj 61A273KS would be essential to evaluate the performance of strains with engineered ndvA under realistic agricultural conditions .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.