Recombinant Bradyrhizobium japonicum Glucans biosynthesis glucosyltransferase H (opgH)

Shipped with Ice Packs
In Stock

Description

Substrate Specificity and Mechanism

  • Primary substrate: UDP-glucose, utilized to synthesize linear β-1,2-glucan chains in E. coli .

  • Activity modulation: Dependent on nutrient availability and growth rate. In nutrient-rich conditions, OpGH localizes to the division septum, delaying cell division by sequestering FtsZ .

  • Structural analysis: The enzyme’s cytoplasmic domain interacts with FtsZ polymers, while its transmembrane region facilitates glucan export to the periplasm .

Product Characteristics

  • Glucan structure: Cyclic glucans with an average molecular weight of 2,100 Da, lacking reducing termini .

  • Biological role: Maintains periplasmic osmotic balance and influences pathogenicity in Proteobacteria .

Expression System

  • Host: E. coli (high-yield expression system) .

  • Yield: Lyophilized powder form, stable under recommended storage conditions .

Industrial and Research Applications

  • Enzyme characterization: Used to study glucan biosynthesis mechanisms in symbiotic bacteria .

  • Biotechnological tools: Recombinant OpGH aids in probing bacterial cell division and osmotic adaptation pathways .

Key Studies

  1. Functional divergence: Unlike Bacillus subtilis UgtP, OpGH inhibits FtsZ polymerization independently of UDP-glucose binding, highlighting convergent evolution in cell size regulation .

  2. Operon organization: The opgGH operon is conserved in γ-Proteobacteria, with opgG encoding a periplasmic β-1,2-glucanase required for OPG branching .

  3. Agricultural relevance: While not directly linked to nodulation in Bradyrhizobium-legume symbiosis, OPGs are hypothesized to support stress tolerance during host infection .

Challenges and Future Directions

  • Structural resolution: The full 3D structure of OpGH remains uncharacterized, limiting mechanistic insights.

  • Enzyme engineering: Modifying substrate specificity could enable tailored glucan production for industrial use (e.g., biodegradable materials).

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will fulfill your request if possible.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: Our proteins are typically shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are settled at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference point.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Please note: The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
opgH; bll8053; Glucans biosynthesis glucosyltransferase H
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-748
Protein Length
full length protein
Species
Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110)
Target Names
opgH
Target Protein Sequence
MASELPMFGQGAGVDRAACLPGAERCAGLRGLDLSMDALKQAQAPLRSAPTRPFLPQESP LSMLPCRLDRAADVRRSPVLAGATLIVRRLFIFVGTALLTLAGGYGMYDVVKVGGVTFLE ALLLGLFLVLLAWVAFSFMSALAGFFVLLTRRQPNLPIDTTGPLPHVTSRTAMLLPTYNE DPHHVMARLRAMYESIDATGYGEQFDWFLLSDTTDPDIWISEEMAFIELRRACGGDQLYY RHRSDNTARKSGNIADWVTRFGAAYDHMIVLDADSLMEGDTIVRLVHAMERTPSCALIQT QPVIVNARTLFSRLQQFAGRVYGPLITAGNAWWHDGDGNYWGHNAIIRLKAFAAEAGLPE LRGRKPFGGHILSHDFVEAALMRRAGWAIYMVPAVRGSFEEVPPSLLDFAGRDRRWCQGN LQHLAVLPTRGLHWVSRLHLLTGIGSYVTAPLWLLFLLVGLLISLQAHFIRPEYFPKGFS LFPTWPQQDPVLAAWVFAATMGLLILPKLLAYLVLISNREERTGFAGSGRVLAGVVCEAF VAALLAPCMMILQTKAVMEILAGRDAGWQVQRRGDGQLARGEVYRKLAGPTLCGLVLSVC AYSVSLPLLLWMSPVVLGLLLSIPLGIMTSLQLSAPGVFATPEINEPPAVVLRANELAAA EPTEMAGALRQLSRDPELLAEHLGSQSPASSRRFGPVDVPLATATAKVARCESLDDVLAW FDKLEMRAVLENPTLLRRILELPAGGRD
Uniprot No.

Target Background

Function
Glucans biosynthesis glucosyltransferase H (OpgH) plays a crucial role in the biosynthesis of osmoregulated periplasmic glucans (OPGs).
Database Links

KEGG: bja:bll8053

STRING: 224911.bll8053

Protein Families
Glycosyltransferase 2 family, OpgH subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What are the structural characteristics of B. japonicum cyclic glucans?

B. japonicum produces periplasmic cyclic beta-(1→3),beta-(1→6)-D-glucans during growth in hypoosmotic environments. These molecules typically contain 10 to 13 glucose units per ring connected primarily through β-1,3 and β-1,6 glycosidic linkages . The specific arrangement of these linkages is critical for proper function, as alterations in glucan structure (such as those seen in ndvC mutants) can severely impair symbiotic interactions with host plants while having limited effects on osmotic adaptation .

How do cyclic glucans function in B. japonicum?

Cyclic glucans in B. japonicum serve dual functions. First, they act as osmoregulators, helping the bacteria adapt to hypoosmotic environments by balancing periplasmic osmotic pressure . Second, they play specific roles in plant-microbe interactions, facilitating successful symbiotic relationships with host plants such as soybean (Glycine max) . The intact structure of these molecules is essential for proper nodule development and symbiotic nitrogen fixation, as evidenced by the significant impairment observed in mutants producing structurally altered glucans .

Which key genes are involved in glucan biosynthesis in B. japonicum?

The ndvB and ndvC genes are primarily responsible for cyclic glucan synthesis in B. japonicum . The ndvC gene encodes a predicted polypeptide (approximately 62 kDa) with several transmembrane domains and contains a sequence characteristic of a conserved nucleoside-sugar-binding motif found in many bacterial enzymes . This protein shares 51% similarity with a beta-glucanosyltransferase from Candida albicans. The ndvB gene product works in concert with ndvC to produce functional cyclic glucans with the appropriate linkage distribution .

What are effective methods for generating and selecting site-directed mutants in B. japonicum?

Creating site-directed mutants in B. japonicum presents unique challenges due to the organism's slow growth and high incidence of spontaneous antibiotic resistance . An efficient approach involves using antibiotic cassettes (kanamycin or spectinomycin) to replace target DNA fragments through homologous recombination . The screening process includes:

  • Initial plate selection for antibiotic-resistant mutants

  • Colony streaking on selective media

  • Cell lysis directly on nitrocellulose filters

  • DNA hybridization to identify recombinant mutants

This methodology eliminates the need to isolate genomic DNA from each mutant for Southern hybridization, significantly accelerating the screening process . For glucan biosynthesis studies, targeting genes like ndvC using this approach can generate mutants with altered glucan structures for functional analysis .

How can proteogenomic approaches enhance our understanding of B. japonicum gene expression?

Proteogenomic analysis using integrated tools like GenoSuite can validate, refine, and discover protein-coding genes in B. japonicum through high-throughput mass spectrometry (MS) data analysis . This approach has successfully confirmed 31% of known genes, refined 49 gene models for their translation initiation sites (TIS), and discovered 59 novel protein-coding genes in B. japonicum USDA110 . For glucan biosynthesis research, this methodology can:

  • Validate the expression of predicted glucosyltransferases

  • Identify novel proteins involved in the glucan biosynthesis pathway

  • Refine gene models for more accurate understanding of protein structure and function

  • Discover previously unannotated genes that may contribute to glucan modification or regulation

Focused analysis on N-terminally acetylated peptides can precisely determine translation initiation sites, as demonstrated for gene blr0594 in B. japonicum .

What strategies can be employed to create B. japonicum strains with modulated glucan synthesis?

Creating B. japonicum strains with altered glucan synthesis capabilities can be achieved through several approaches:

  • Targeted mutagenesis: Introducing Tn5 insertions into glucan biosynthesis genes (ndvB, ndvC) to disrupt or modify their function .

  • Mutator phenotype induction: Utilizing plasmids containing mutated dnaQ genes (which encode the epsilon subunit of DNA polymerase III) to generate a mutator phenotype. For example, the pKQ2 plasmid containing a mutated B. japonicum dnaQ gene can be introduced via triparental mating using pRK2013 as a helper plasmid . Specific mutations in conserved amino acid motifs (e.g., replacing 7Asp with 7Ala, and 9Glu with 9Ala) can generate mutator phenotypes .

  • Selection under specific environmental pressures: Growing the mutated strains under conditions that select for altered glucan production or function .

Transconjugants can be selected on appropriate media containing antibiotics like tetracycline (100 μg/ml) and polymyxin B (50 μg/ml) .

How does the structure-function relationship of glucosyltransferases influence glucan synthesis and bacterial physiology?

The structure-function relationship of glucosyltransferases critically determines both glucan synthesis and broader bacterial physiological processes. In B. japonicum, the ndvC gene product contains a conserved nucleoside-sugar-binding motif essential for proper enzymatic function . Mutations in this gene result in altered cyclic beta-glucans composed almost entirely of beta-(1→3)-glycosidic linkages rather than the typical mixed beta-(1→3),beta-(1→6) pattern .

While structurally altered glucans retain some function in osmotic adaptation (with mutants showing only slight sensitivity to hypoosmotic conditions), they severely impair symbiotic interactions with soybean . This differential impact suggests distinct structural requirements for osmoregulation versus symbiotic signaling.

In other bacterial systems like E. coli, the glucosyltransferase OpgH serves as a moonlighting enzyme that links central metabolism to cell size regulation . When expressed in E. coli, thio-opgH-his fusion proteins cause severe filamentation (increasing cell length over five-fold), indicating a role in cell division inhibition . This function requires UDP-glucose, as demonstrated by the lack of division inhibition in pgm::kan backgrounds (which cannot synthesize UDP-glucose) or with mutations in OpgH's UDP-glucose binding site .

What are the molecular mechanisms underlying the dual functions of glucosyltransferases in metabolism and cell division?

The dual functionality of glucosyltransferases involves sophisticated molecular mechanisms:

  • Enzymatic activity: The primary function involves transferring glucose moieties to create specific glycosidic linkages in glucan molecules. In B. japonicum, this results in mixed beta-(1→3),beta-(1→6)-linked cyclic glucans .

  • Metabolic sensing: In E. coli, OpgH functions as a UDP-glucose-dependent regulator of cell division. OpgH's activity is directly tied to UDP-glucose availability, making it a metabolic sensor that links nutrient status to cell division .

  • Protein-protein interactions: In E. coli, OpgH localizes to the nascent septal site during growth in nutrient-rich conditions, where it antagonizes assembly of the tubulin-like cell division protein FtsZ . Biochemical analyses suggest OpgH sequesters FtsZ from growing polymers, delaying division and increasing cell size .

  • Subcellular localization: OpgH exhibits both peripheral and midcell localization patterns that vary with growth conditions. In nutrient-rich environments (τ = 21), OpgH colocalizes with FtsZ at midcell in 96% of cells, but this colocalization decreases significantly under nutrient-limited conditions .

While these mechanisms are well-characterized in E. coli, determining whether similar moonlighting functions exist for B. japonicum glucosyltransferases represents an important research frontier.

How do variations in UDP-glucose availability affect glucosyltransferase function across different growth conditions?

UDP-glucose availability serves as a critical metabolic signal that modulates glucosyltransferase function across varying growth conditions. In E. coli, OpgH's cell division inhibition function is absolutely dependent on UDP-glucose availability . When UDP-glucose synthesis is disrupted (as in pgm::kan backgrounds) or when OpgH's UDP-glucose binding site is mutated (PIC249AIA), the protein loses its ability to inhibit cell division .

The regulatory relationship between UDP-glucose and glucosyltransferase function creates a sophisticated mechanism linking:

  • Nutrient availability: In nutrient-rich environments, increased carbon flux produces higher UDP-glucose levels, activating OpgH's division inhibition function .

  • Growth rate: OpgH's subcellular localization changes with growth rate. At fast growth rates (τ = 21), OpgH shows strong colocalization with FtsZ at midcell (96%), but this decreases to just 36% at moderate growth rates (τ = 38) and drops to 3% at slow growth rates (τ = 60) .

  • Osmotic conditions: In B. japonicum, cyclic glucan production increases under hypoosmotic conditions , suggesting that osmotic stress may alter UDP-glucose allocation between metabolic pathways.

In B. japonicum, determining how UDP-glucose availability affects the balance between glucan synthesis and potential cell division regulation functions under varying environmental conditions represents an important area for further investigation.

How can researchers address the challenges of distinguishing between direct and indirect effects in glucosyltransferase mutant phenotypes?

Distinguishing between direct and indirect effects in glucosyltransferase mutant phenotypes presents several challenges:

  • Pleiotropic effects: Mutations in glucan biosynthesis genes often produce multiple phenotypic changes. For instance, ndvC mutants in B. japonicum show both altered glucan structure and impaired symbiotic capacity .

  • Metabolic ripple effects: Changes in glucan synthesis can affect UDP-glucose allocation, potentially impacting other glucose-dependent pathways.

  • Regulatory network disruptions: Glucosyltransferases may participate in regulatory networks beyond their enzymatic functions, as seen with OpgH's role in E. coli cell division .

To address these challenges, researchers should employ:

  • Complementation studies: Reintroducing wild-type genes into mutants to confirm phenotype restoration

  • Site-directed mutagenesis: Creating mutations that specifically target different functional domains

  • Biochemical activity assays: Directly measuring enzymatic activities in vitro

  • Metabolomic profiling: Assessing global metabolic changes resulting from mutations

  • Protein-protein interaction studies: Identifying direct binding partners and effects on cellular pathways

A comprehensive approach using these methodologies can help differentiate primary effects from secondary consequences in complex biological systems.

What considerations are important when comparing glucosyltransferase functions across different bacterial species?

When comparing glucosyltransferase functions across different bacterial species, researchers should consider:

  • Evolutionary convergence versus homology: Despite functional similarities, the glucosyltransferases OpgH (E. coli) and UgtP (Bacillus subtilis) share no homology, have distinct enzymatic activities, and inhibit FtsZ assembly through different mechanisms . This represents a striking example of convergent evolution.

  • Species-specific regulatory contexts: The regulatory networks governing glucosyltransferase expression and activity may differ significantly between species.

  • Structural variations: Similar enzymes may show important structural differences affecting substrate specificity, catalytic efficiency, or protein-protein interactions.

  • Environmental adaptations: Species-specific adaptations to different ecological niches may influence glucosyltransferase function and regulation.

  • Methodological considerations: Techniques optimized for one bacterial species may require modification for others. For example, B. japonicum's slow growth and high spontaneous antibiotic resistance necessitate specialized approaches for genetic manipulation .

Comparative analyses should include careful phylogenetic studies, structural modeling, and functional assays across multiple species to accurately interpret similarities and differences.

What emerging technologies could advance our understanding of glucosyltransferase regulation and function?

Several emerging technologies hold promise for advancing glucosyltransferase research:

  • CRISPR-Cas9 genome editing: Enabling more precise genetic modifications in B. japonicum to study specific functional domains of glucosyltransferases.

  • Advanced proteomics and interactomics: Identifying interaction networks and post-translational modifications that regulate glucosyltransferase activity under various environmental conditions.

  • Single-cell analysis technologies: Examining cell-to-cell variability in glucan production and glucosyltransferase localization within bacterial populations.

  • Super-resolution microscopy: Providing detailed visualization of glucosyltransferase localization and dynamics in living cells with nanometer precision.

  • Computational modeling: Predicting glucosyltransferase structure-function relationships and simulating metabolic effects of altered enzyme activities.

  • Synthetic biology approaches: Engineering novel glucosyltransferase variants with modified substrate specificities or regulatory properties.

These technologies could reveal previously unrecognized aspects of glucosyltransferase function and regulation, particularly regarding potential moonlighting functions similar to those observed in E. coli OpgH .

How might advanced understanding of glucosyltransferase function contribute to agricultural applications?

Enhanced understanding of B. japonicum glucosyltransferases could advance agricultural applications through:

  • Improved symbiotic efficiency: Engineering B. japonicum strains with optimized glucan production could enhance nitrogen fixation in legume crops, reducing dependence on chemical fertilizers .

  • Stress tolerance: Modified glucan structures might improve bacterial survival under environmental stresses, extending the range of conditions suitable for effective symbiosis .

  • Host range expansion: Understanding the molecular basis of host-specific interactions could lead to strategies for expanding the range of plant species capable of forming productive symbioses with B. japonicum.

  • Precision agriculture: Tailoring bacterial inoculants with specific glucan profiles for different environmental conditions or crop varieties.

  • Novel biofertilizers: Developing enhanced biofertilizer formulations based on optimized B. japonicum strains with improved colonization and nodulation capabilities.

The fundamental research on glucosyltransferases thus provides essential knowledge for developing sustainable agricultural solutions that reduce environmental impacts while maintaining or improving crop productivity.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.