Recombinant Bradyrhizobium japonicum Heme exporter protein B (cycW)

Shipped with Ice Packs
In Stock

Description

Protein Overview

Recombinant Bradyrhizobium japonicum Heme Exporter Protein B (cycW), also known as Cytochrome c-type biogenesis protein CycW, is a membrane-associated protein critical for heme transport and cytochrome c maturation. It is encoded by the ccmB gene (synonym cycW) and functions as part of a multi-component system responsible for exporting heme, a vital cofactor in cellular respiration and electron transport . This protein is produced recombinantly in hosts such as E. coli, yeast, or mammalian cells, with purity levels ≥85% as confirmed by SDS-PAGE .

Genetic Context

  • Gene Locus: blr0468 (strain USDA 110) .

  • Synonyms: ccmB, cycW .

  • Amino Acid Sequence: Comprises 222 residues (UniProt ID: P30964) with a conserved motif (WxWD) critical for heme handling .

Functional Role in Heme Export

CycW operates within the cytochrome c maturation (Ccm) pathway:

  1. Heme Translocation: Partners with CcmA (ATP-binding protein) and CcmCD to transport heme across the cytoplasmic membrane .

  2. Chaperone Interaction: Delivers heme to the periplasmic chaperone CcmE for subsequent covalent attachment to apocytochromes .

  3. Stress Adaptation: Indirectly supports bacterial survival under environmental stressors by maintaining heme homeostasis, crucial for symbiotic nitrogen fixation in B. japonicum .

Expression Systems

  • Hosts: E. coli, yeast, baculovirus, or mammalian cells .

  • Purification: Utilizes affinity tags (e.g., His-tag) and Tris-based buffers with 50% glycerol for stability .

Key Applications

  • Enzyme-Linked Immunosorbent Assay (ELISA): Commercial kits (e.g., CSB-CF330040BVW) leverage recombinant cycW for antibody detection .

  • Heme Biosynthesis Studies: Engineered microbial systems (e.g., Bacillus subtilis) use homologs of cycW to enhance heme secretion for industrial production .

Research Findings and Comparative Analysis

  • Desiccation Stress: B. japonicum mutants lacking heme-related proteins show reduced survival under low humidity, underscoring cycW’s role in stress resilience .

  • Cross-Species Homology: B. japonicum cycW shares functional parallels with E. coli CcmB and Brucella BhuQ, though regulatory mechanisms differ .

OrganismHeme Exporter SystemKey Function
Bradyrhizobium japonicumCcmABCD (cycW-ccmB, cycZ-ccmC)Symbiotic nitrogen fixation
Escherichia coliCcmABCD/ECytochrome c maturation
Bacillus subtilisEngineered ccmABCIndustrial heme production

Future Directions

Advanced structural studies and metabolic engineering could optimize cycW’s efficiency in heme export, with applications in biotechnology and agriculture. Further exploration of its interaction with stress-response pathways (e.g., chaperones GroEL/GroES) may enhance its utility in developing stress-tolerant rhizobial strains.

Product Specs

Form
Lyophilized powder
Please note that we prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply for dry ice shipping.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
cycW; ccmB; blr0468; Heme exporter protein B; Cytochrome c-type biogenesis protein CycW
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-222
Protein Length
full length protein
Species
Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110)
Target Names
cycW
Target Protein Sequence
MTALSALIRRDIRIALRVGGGALIGVLFFLTVVVLMPFAVGPDLALLSRLGPAILWLGAL LASLLTLDRLFMADHEDGSLDLITMSRTPLELACAAKALAHWLAAGLPLIVATPVLGLLL NLDMVATGAVALTLLAGTPALTFTGMIGAALAVTLHRGGLLMAVLVLPLSIPVLIFGVAA SQAVIVGPMSFGAPFSILCALSLVSLVIGPFAAAASLRHGLD
Uniprot No.

Target Background

Function
This protein plays a crucial role in exporting heme to the periplasm, which is essential for the biogenesis of c-type cytochromes.
Database Links

KEGG: bja:blr0468

STRING: 224911.blr0468

Protein Families
CcmB/CycW/HelB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the role of heme exporter protein B (cycW) in Bradyrhizobium japonicum?

Heme exporter protein B (cycW) in B. japonicum functions within the cytochrome c maturation (Ccm) system to facilitate heme transport across the bacterial membrane. This protein works in concert with other Ccm components to ensure proper delivery of heme to apocytochromes during c-type cytochrome biogenesis. The Ccm system in B. japonicum is particularly important because c-type cytochromes of the bc1 complex and cbb3-type oxidase are essential for the bacterium's symbiotic nitrogen fixation with host legumes such as soybeans .

What structural features are critical for heme binding in B. japonicum cytochrome c biogenesis proteins?

The critical structural feature for heme binding in B. japonicum CcmE (CycJ) is a strictly conserved histidine residue (H122), which serves as the site for covalent heme attachment. Mutation of this histidine to alanine (H122A) completely abolishes the protein's ability to bind heme and support cytochrome c maturation . In the membrane protein CcmC (CycZ), a conserved tryptophan-rich motif and flanking histidines are essential for its function in incorporating heme into CcmE, possibly through direct interaction with the heme molecule .

What are the recommended methods for expressing recombinant B. japonicum heme-binding proteins in heterologous hosts?

For expressing recombinant B. japonicum heme-binding proteins, the arabinose-inducible expression system has proven effective. Specifically, the B. japonicum ccmE gene can be amplified by PCR and cloned into arabinose-inducible expression vectors such as pISC-2. When expressing these proteins in E. coli, it's advantageous to use E. coli strains with deletions in the corresponding ccm genes to avoid interference from host proteins. For optimal results, expression conditions should include anaerobic growth with nitrite as an electron acceptor to ensure expression of the ccm operon .

The following table summarizes key expression parameters:

ParameterRecommended Condition
Expression VectorArabinose-inducible (e.g., pISC-2)
Host StrainE. coli with corresponding ccm gene deletions
Growth ConditionsAnaerobic with nitrite as electron acceptor
Detection MethodHeme staining of membrane proteins or periplasmic fractions
Protein TaggingHexahistidine tags do not interfere with protein function

What techniques are most effective for detecting and quantifying heme binding to recombinant B. japonicum proteins?

The most effective technique for detecting heme binding to recombinant B. japonicum proteins is heme staining following SDS-PAGE separation of membrane proteins or periplasmic fractions. This technique specifically visualizes proteins with covalently bound heme. For quantification and confirmation of protein expression levels, Western blotting with specific antibodies against the target protein can be performed in parallel. When working with low-abundance proteins like CcmE, overexpression is typically necessary to achieve detectable levels of the heme-bound form .

To verify the specificity of heme binding, site-directed mutagenesis of conserved residues (particularly the H122 in CcmE) provides crucial controls. Additionally, hexahistidine tags can be added to these proteins without interfering with their function, facilitating purification and detection .

How can researchers assess the functionality of recombinant B. japonicum heme transport proteins?

Researchers can assess the functionality of recombinant B. japonicum heme transport proteins through complementation assays in appropriate mutant backgrounds. For example, to test CcmE (CycJ) function, expression of the protein in an E. coli ΔccmE strain harboring a plasmid for cytochrome c expression (such as cytochrome c550 encoded by cycA) allows evaluation of the protein's ability to support cytochrome c maturation. Functional complementation is detected by heme staining of periplasmic proteins, which reveals the presence of mature holocytochromes .

For CcmC (CycZ) functionality assessment, the protein's ability to incorporate heme into CcmE can be tested by co-expressing both proteins in an E. coli strain lacking endogenous ccm genes. The formation of holo-CcmE, detected by heme staining, indicates functional CcmC activity. Comparative analysis with wild-type proteins and site-directed mutants provides valuable insights into structure-function relationships .

How do genomic variations in B. japonicum strains affect heme transport system efficiency?

Genomic variations among B. japonicum strains can significantly impact the efficiency of heme transport systems. Natural populations of B. japonicum exhibit considerable genetic diversity, including variations in repetitive sequence elements that may influence gene expression patterns. Some isolates, designated as highly reiterated sequence-possessing (HRS) isolates, contain remarkably high copy numbers of repetitive sequences RSα (ranging from 86 to 175 copies) and RSβ (ranging from 22 to 51 copies), compared to normal isolates with only 5-9 copies of RSα and 2-9 copies of RSβ .

These genomic variations can potentially affect the expression and function of symbiosis-related genes, including those involved in heme transport. Research has shown that HRS isolates display shifts and duplications in nif- and hup-specific hybridization bands and exhibit slower growth compared to normal isolates, although their symbiotic properties remain similar . This suggests complex interactions between genomic architecture and the regulation of symbiosis-related pathways, which may include the heme transport systems essential for cytochrome c maturation and symbiotic nitrogen fixation.

What are the evolutionary implications of horizontal gene transfer for B. japonicum heme export systems?

The evolutionary history of B. japonicum heme export systems is complex and potentially influenced by horizontal gene transfer events. Phylogenetic analysis of B. japonicum strains has revealed that symbiotic capabilities, including those dependent on properly functioning heme transport systems, can be lost over evolutionary time . These losses may be driven by mutations or deletions of symbiosis loci, which could include genes encoding components of the cytochrome c maturation system.

The relatively low amino acid identity between B. japonicum and E. coli Ccm proteins (45% for CcmE, 49% for CcmC, and only 25% for CcmD) suggests substantial evolutionary divergence . Despite these differences, the proteins can functionally interact across species boundaries, indicating conservation of critical interaction domains. This functional compatibility across divergent species suggests that the basic mechanism of cytochrome c maturation, including heme transport, is ancient and fundamental to bacterial physiology.

How do protein-protein interactions within the B. japonicum heme transport complex regulate heme delivery?

The regulation of heme delivery in B. japonicum involves a complex network of protein-protein interactions within the cytochrome c maturation system. The current model suggests that CcmC (CycZ), CcmE (CycJ), and the small membrane protein CcmD interact to facilitate heme transfer from the cytoplasm to apocytochrome c in the periplasm .

In this model, CcmC functions to incorporate heme covalently into CcmE at a conserved histidine residue. The heme-loaded CcmE then acts as a periplasmic heme chaperone, transferring the heme group to apocytochrome c, which contains a conserved CXXCH motif for thioether bond formation . The regulation of these interactions ensures that heme is properly delivered to its final destination without causing potential toxicity from free heme.

The fact that B. japonicum CcmC (CycZ) displays higher activity in forming holo-CcmE when expressed in E. coli compared to E. coli's native CcmC suggests that species-specific adaptations in protein-protein interaction interfaces may optimize the efficiency of heme transfer within the native cellular environment .

What are the major technical challenges in studying recombinant B. japonicum heme export proteins?

Studying recombinant B. japonicum heme export proteins presents several technical challenges. One significant challenge is the detection of heme-bound intermediates, as demonstrated by the difficulty in visualizing holo-CcmE in wild-type B. japonicum even when expressed from its natural promoter on a low-copy-number plasmid . This suggests that these intermediates are transient and present at low concentrations under physiological conditions.

Another challenge is establishing appropriate expression systems that maintain the native functionality of these membrane-associated proteins. While arabinose-inducible systems have proven effective, careful consideration must be given to expression levels, as overexpression can lead to aggregation or misfolding of membrane proteins. Additionally, the reconstitution of multi-component systems requires the correct stoichiometry of all participating proteins for optimal function .

Future technical advances might include the development of more sensitive detection methods for transient heme-protein intermediates and improved membrane protein expression systems specifically optimized for B. japonicum proteins.

How might structural biology approaches advance our understanding of B. japonicum heme export mechanisms?

Structural biology approaches, including X-ray crystallography, cryo-electron microscopy, and NMR spectroscopy, could significantly advance our understanding of B. japonicum heme export mechanisms. These techniques could:

  • Reveal the precise structural basis for the covalent attachment of heme to the conserved histidine residue in CcmE

  • Elucidate the conformational changes that occur during heme transfer from CcmC to CcmE and subsequently to apocytochrome c

  • Identify the interaction interfaces between different components of the cytochrome c maturation system

  • Provide insights into species-specific structural adaptations that may explain functional differences between B. japonicum and other bacterial heme transport systems

The application of these structural biology approaches would be particularly valuable for understanding the tryptophan-rich motif and flanking histidines in CcmC that are implicated in heme binding . Structural data could clarify whether these residues directly coordinate the heme iron or instead create a binding pocket that positions the heme for transfer to CcmE.

What implications do B. japonicum heme transport systems have for engineering improved nitrogen fixation in agriculture?

B. japonicum heme transport systems have significant implications for engineering improved nitrogen fixation in agriculture because they are essential for the formation of functional c-type cytochromes, which in turn are required for symbiotic nitrogen fixation. The c-type cytochromes of the bc1 complex and cbb3-type oxidase in B. japonicum are crucial for the bacterium's ability to fix nitrogen within soybean root nodules .

Research has shown that bacterial evolution outside of the host can favor traits that promote an independent lifestyle at the expense of symbiotic function, potentially leading to the erosion of symbiotic capabilities over time . This evolutionary challenge must be addressed when developing strategies to enhance nitrogen fixation through modification of heme transport systems.

How does research on B. japonicum heme transporters contribute to our understanding of bacterial symbiosis?

Research on B. japonicum heme transporters provides critical insights into the molecular underpinnings of bacterial symbiosis, particularly regarding the establishment and maintenance of mutually beneficial relationships with legume hosts. The proper functioning of heme transport systems is essential for the formation of c-type cytochromes, which in turn support the energy-intensive process of nitrogen fixation within root nodules .

This research highlights the complex adaptations required for effective symbiosis, including specialized pathways for cofactor biosynthesis and delivery. The fact that c-type cytochromes of the bc1 complex and cbb3-type oxidase are specifically required for symbiotic nitrogen fixation underscores the importance of these heme-containing proteins in the symbiotic lifestyle .

Furthermore, understanding the molecular mechanisms of heme transport in B. japonicum contributes to our knowledge of how bacteria adapt to different environments, including transitions between free-living soil conditions and the specialized environment within plant root nodules.

What parallels exist between B. japonicum heme export systems and those in pathogenic bacteria?

The cytochrome c maturation (Ccm) system in B. japonicum shares fundamental similarities with those found in pathogenic bacteria, particularly other α- and γ-proteobacteria. The conservation of key components like CcmC, CcmE, and CcmD across diverse bacterial species suggests a common evolutionary origin for these heme transport mechanisms .

In pathogenic bacteria, c-type cytochromes often contribute to virulence by supporting adaptation to host environments, electron transport during infection, and resistance to host defense mechanisms. The mechanisms of heme acquisition, transport, and incorporation into cytochromes in pathogens face similar biochemical challenges to those in symbionts like B. japonicum.

The ability of B. japonicum CcmC and CcmE to functionally complement their E. coli counterparts despite significant sequence divergence highlights the conservation of critical functional domains across diverse bacterial species . This conservation may reflect fundamental constraints on the evolution of heme transport systems, which must handle a potentially toxic cofactor with precise specificity.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.