Recombinant Bradyrhizobium japonicum Heme exporter protein C (cycZ)

Shipped with Ice Packs
In Stock

Description

Functional Role in Heme Export and Cytochrome c Maturation

cycZ (also termed CcmC) is part of the cytochrome c maturation (Ccm) system, which ensures covalent heme attachment to apocytochromes. Key functions include:

  • Heme Translocation: cycZ interacts with CcmAB to shuttle heme across the cytoplasmic membrane .

  • Heme Chaperone Activation: It loads heme onto the periplasmic chaperone CcmE, which transfers heme to apocytochrome c .

  • Cross-Species Conservation: B. japonicum cycZ complements E. coli ccm mutants, demonstrating functional homology .

Mechanistic Insights:

  • Cryo-EM studies reveal that the CcmABCD complex (including cycZ) flips heme to the periplasmic leaflet via ATP hydrolysis .

  • A conserved tryptophan-rich motif in cycZ positions heme for covalent binding to CcmE .

Biochemical Studies

  • Heme Transport Assays: Used to analyze heme translocation kinetics in proteobacteria .

  • Cytochrome c Maturation: Essential for reconstituting c-type cytochrome activity in heterologous systems .

Biotechnological Relevance

  • Heme Overproduction: Overexpression of cycZ in Bacillus subtilis enhances heme secretion, aiding industrial heme synthesis .

  • Protein Interaction Mapping: Identifies binding partners in heme-handling pathways .

Functional Complementation

  • B. japonicum cycZ restored cytochrome c maturation in E. coli ccmC mutants, achieving 46% heme transfer efficiency compared to native E. coli CcmC .

Mutational Analysis

  • His122 in cycZ is critical for heme binding; its mutation (H122A) abolishes heme transfer to CcmE .

Comparative Analysis of cycZ Homologs

OrganismHomologFunctionIdentity to B. japonicum cycZ
E. coliCcmCHeme translocation, CcmE activation49%
Rhodobacter capsulatusCycJCytochrome c biogenesis45%

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer ingredients, storage temperature, and the protein's intrinsic stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
cycZ; ccmC; blr0469; Heme exporter protein C; Cytochrome c-type biogenesis protein CycZ
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-263
Protein Length
full length protein
Species
Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110)
Target Names
cycZ
Target Protein Sequence
MTLIDLANPTRFLALTARVLPWLAAATVILLAIGLYQSALAPDDYQQGATVKIMFIHVPN AWLSMFVWGVMSIASLGTLVWRHPLADVAAKAAAPIGAAFTFLALLTGSLWGRPMWGTYW EWDARLTSVLILFLMYLGLMALWRAVDDPSRAARAAAVLTLVGAINLPIIKFSVDWWNTL HQPASVMRMGGSSLDKSFLIPLLVMAIAFTLLFVTLHLAAMRNEILRRRVRSLQMMQASR MAFSSEMGAGSRQNNASNEVGAA
Uniprot No.

Target Background

Function
Essential for the export of heme to the periplasm, a crucial step in the biogenesis of c-type cytochromes.
Database Links

KEGG: bja:blr0469

STRING: 224911.blr0469

Protein Families
CcmC/CycZ/HelC family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Bradyrhizobium japonicum Heme exporter protein C (cycZ) and what is its primary function?

Heme exporter protein C (cycZ) in B. japonicum is the ortholog of CcmC in Escherichia coli and functions as an integral membrane protein essential for cytochrome c maturation. Its primary role is to incorporate heme covalently into CcmE (CycJ), which then acts as a periplasmic heme chaperone in the cytochrome c biogenesis pathway . In B. japonicum, c-type cytochromes of the bc1 complex and cbb3-type oxidase are essential for symbiotic nitrogen fixation, making cycZ an important component of the symbiotic relationship with host plants . The protein contains a conserved tryptophan-rich motif and flanking histidines that are believed to be involved in heme interaction and handling .

How does cycZ contribute to the symbiotic capabilities of Bradyrhizobium japonicum?

While cycZ does not directly participate in nodulation, it plays a critical indirect role in symbiotic nitrogen fixation. In B. japonicum, c-type cytochromes are essential components of the electron transport chain that powers nitrogen fixation in root nodules . By ensuring proper cytochrome c maturation, cycZ contributes to the bacterium's ability to function as an effective symbiont. The c-type cytochromes in the bc1 complex and cbb3-type oxidase are specifically required for symbiotic nitrogen fixation . Without proper cytochrome c maturation facilitated by cycZ, B. japonicum would be unable to generate the energy required for the highly demanding process of nitrogen fixation within legume nodules.

What is the relationship between cycZ and cycJ (CcmE) in the heme delivery pathway?

The relationship between cycZ and cycJ in B. japonicum represents a critical step in the cytochrome c maturation pathway. CycZ (CcmC) functions as the heme loading protein that incorporates heme covalently into CycJ (CcmE) . Once loaded with heme, CycJ acts as a periplasmic heme chaperone that can transfer the heme group to apocytochrome c . In experimental studies, CcmC from B. japonicum expressed in E. coli was shown to be capable of inserting heme into CcmE, demonstrating the conservation of this functional relationship across bacterial species . The process involves specific protein-protein interactions between CcmC, CcmE, and the small membrane protein CcmD, forming a heme delivery system that ensures proper cytochrome c maturation .

What expression systems are optimal for producing recombinant B. japonicum cycZ?

For recombinant expression of B. japonicum cycZ, E. coli has been successfully used as a heterologous host. In published research, cycZ was amplified by PCR and cloned into the expression vector pISC-2, allowing for controlled expression in E. coli . When selecting an expression system, researchers should consider:

  • Membrane protein expression capabilities: Since cycZ is an integral membrane protein, expression systems optimized for membrane proteins are preferable.

  • Induction control: Systems with tight regulation of expression are essential to prevent toxicity.

  • Fusion tags: Addition of affinity tags can facilitate purification while maintaining protein functionality.

Expression in E. coli is advantageous because it allows for complementation studies to determine functionality, as demonstrated when B. japonicum cycZ was able to insert heme into E. coli CcmE despite only 49% amino acid identity between the CcmC proteins of these species .

How can researchers verify the functional activity of recombinant cycZ?

Functional verification of recombinant cycZ can be achieved through several complementary approaches:

  • Complementation assays: Express recombinant cycZ in a ccmC deletion mutant of E. coli and assess its ability to restore cytochrome c maturation. Success is indicated by the restoration of holocytochrome formation, which can be visualized through heme staining of periplasmic proteins after SDS-PAGE separation .

  • Heme incorporation assay: Assess the ability of recombinant cycZ to incorporate heme into CcmE by detecting heme covalently bound to CcmE. This can be accomplished through:

    • Isolation of membrane fractions

    • SDS-PAGE separation

    • Heme staining to detect the covalent heme attachment

    • Western blotting with anti-CcmE antibodies to confirm protein presence

  • Cytochrome c formation analysis: Monitor the formation of mature c-type cytochromes in systems expressing recombinant cycZ through:

    • Periplasmic protein extraction

    • Heme staining to visualize cytochrome c

    • Spectroscopic analysis to detect characteristic absorption spectra

In published studies, both CcmC from E. coli and B. japonicum were able to insert heme into CcmE, though the B. japonicum homolog demonstrated higher activity .

What site-directed mutagenesis targets are most informative for studying cycZ function?

Strategic site-directed mutagenesis of cycZ can reveal critical insights into its mechanism of action. The most informative targets include:

  • Conserved tryptophan-rich motif: This region is implicated in heme interaction and is essential for function. Mutating these residues can help determine their specific roles in heme handling .

  • Flanking histidines: These conserved residues are thought to be involved in heme coordination. Substitution with alanine or other amino acids can test their importance in heme binding and transfer .

  • Transmembrane domains: Mutations in these regions can help define the protein topology and identify regions involved in interactions with other Ccm proteins.

  • Interface residues: Based on the 49% identity between E. coli and B. japonicum CcmC, mutating non-conserved residues at potential interaction interfaces with CcmE or CcmD can provide insights into species-specific protein-protein interactions .

When designing mutagenesis experiments, researchers should consider complementary approaches such as:

  • Conservative vs. non-conservative substitutions

  • Creation of chimeric proteins between E. coli and B. japonicum homologs

  • Serial truncations to identify minimal functional domains

How do evolutionary relationships between cycZ homologs inform functional studies?

Evolutionary analysis of cycZ homologs provides valuable context for functional studies. Although the amino acid identity between the CcmC proteins of E. coli and B. japonicum is only 49%, the B. japonicum homolog is capable of functioning in E. coli, suggesting conservation of core functional elements . Researchers can leverage evolutionary relationships to:

  • Identify conserved functional domains: Sequence alignment of cycZ homologs across diverse bacterial species can reveal absolutely conserved residues likely critical for function.

  • Recognize species-specific adaptations: Regions of higher sequence divergence may represent adaptations to specific ecological niches or symbiotic relationships.

  • Guide chimeric protein design: Understanding which regions are most conserved can inform the design of chimeric proteins to test domain-specific functions.

  • Contextualize experimental findings: When unexpected functional differences are observed, evolutionary context can help interpret whether these represent ancient divergences or recent adaptations.

The ability of B. japonicum cycZ to function in E. coli despite relatively low sequence identity suggests that protein-protein interactions in the cytochrome c maturation system are robust to substantial sequence variation while maintaining core functionality .

What approaches can resolve the membrane topology and structure of cycZ?

Resolving the membrane topology and structure of cycZ presents significant challenges due to its nature as an integral membrane protein. Researchers can employ multiple complementary approaches:

  • Computational prediction: Use algorithms specifically designed for membrane protein topology prediction based on hydrophobicity profiles, positive-inside rule, and evolutionary conservation.

  • Fusion reporter systems: Create fusions of cycZ fragments with reporters like PhoA (alkaline phosphatase) or GFP, whose activity depends on cellular localization, to map membrane topology.

  • Cysteine scanning mutagenesis: Systematically replace residues with cysteine and assess their accessibility to membrane-impermeable sulfhydryl reagents to determine which regions are exposed to different cellular compartments.

  • Protease protection assays: Expose membrane preparations to proteases and identify protected fragments to determine membrane-embedded regions.

  • Cryo-electron microscopy: For high-resolution structural studies, purify the protein in appropriate detergents or nanodiscs and analyze by cryo-EM.

  • NMR spectroscopy: For specific domains or in combination with selective isotope labeling to resolve structural features.

Understanding the structure-function relationship of cycZ will provide insights into how it interacts with heme and partner proteins like cycJ and CcmD in the cytochrome c maturation system .

How does heme binding to cycZ compare between free-living and symbiotic states of B. japonicum?

The comparison of cycZ function between free-living and symbiotic states of B. japonicum represents an important but challenging research question. While direct comparative data is limited, several experimental approaches can address this question:

  • Differential expression analysis: Compare cycZ expression levels in free-living B. japonicum versus bacteroids isolated from soybean nodules using RT-qPCR or RNA-seq.

  • Protein abundance quantification: Use targeted proteomics to measure cycZ protein levels in different physiological states.

  • Activity assays: Develop in vitro assays to compare heme binding and transfer activity of cycZ isolated from bacteria in different states.

  • In situ labeling: Develop fluorescent heme analogs that can track the activity of the cytochrome c maturation system in living cells under different conditions.

What spectroscopic methods are most suitable for analyzing cycZ-mediated heme transfer?

Several spectroscopic techniques can effectively analyze cycZ-mediated heme transfer, each providing complementary information:

  • UV-Visible absorption spectroscopy:

    • Monitors characteristic Soret and Q bands of heme

    • Can detect changes in heme environment during transfer

    • Allows real-time kinetic measurements of heme transfer reactions

    • Relatively simple and accessible technique

  • Resonance Raman spectroscopy:

    • Provides detailed information about the heme iron coordination state

    • Can distinguish between different heme binding modes

    • Helps identify specific amino acid ligands to the heme iron

    • Requires specialized equipment but offers unique structural insights

  • Electron Paramagnetic Resonance (EPR):

    • Detects paramagnetic species, including certain oxidation states of heme

    • Provides information about the electronic environment of the heme iron

    • Can help distinguish different oxidation and spin states

  • Magnetic Circular Dichroism (MCD):

    • Sensitive to the electronic and magnetic properties of heme

    • Complements EPR data for detailed electronic structure analysis

  • Fluorescence spectroscopy:

    • When using fluorescently labeled components

    • Can monitor protein-protein interactions in real-time

    • Useful for determining binding affinities and kinetics

For studying cycZ function, a combination of these techniques provides the most comprehensive analysis of heme binding, transfer kinetics, and the coordination environment during the cytochrome c maturation process.

How can researchers quantitatively assess the efficiency of recombinant cycZ activity?

Quantitative assessment of recombinant cycZ activity can be approached through several methodologies:

  • Heme incorporation assay quantification:

    • Isolate membrane fractions containing CcmE

    • Perform heme staining after SDS-PAGE

    • Quantify band intensity using densitometry

    • Calculate the ratio of holo-CcmE to total CcmE using parallel Western blots

  • Kinetic analysis:

    • Measure the rate of heme incorporation into CcmE under controlled conditions

    • Determine initial rates at varying substrate concentrations

    • Calculate enzymatic parameters (Km, Vmax) for comparative analysis

  • Competitive activity assay:

    • Compare activity of wild-type versus mutant or homologous cycZ proteins

    • Express multiple variants simultaneously and measure relative efficiency

    • Establish a standardized activity unit based on a reference reaction

  • Cytochrome c maturation efficiency:

    • Measure the complete pathway efficiency by quantifying mature cytochrome c

    • Calculate the ratio of holo-cytochrome to apo-cytochrome as a measure of pathway completion

Published research has demonstrated that B. japonicum CcmC was significantly more active in holo-CcmE formation than E. coli CcmC when expressed in E. coli, despite similar amounts of CcmE polypeptide in membrane protein fractions . This type of comparative analysis provides a quantitative measure of functional efficiency.

What approaches can resolve contradictory results when studying cycZ across different expression systems?

When encountering contradictory results in cycZ studies across different expression systems, researchers should implement a systematic troubleshooting and validation strategy:

  • Expression level normalization:

    • Quantify protein expression using Western blotting with antibodies against cycZ or epitope tags

    • Adjust experimental conditions to achieve comparable expression levels

    • Consider using inducible promoters with titratable expression

  • Host background effects assessment:

    • Characterize the host's endogenous cytochrome c maturation system components

    • Create clean genetic backgrounds by deleting host homologs

    • Test activity in multiple host backgrounds to identify system-specific effects

  • Protein-protein interaction verification:

    • Confirm proper interactions with partner proteins (cycJ, CcmD)

    • Use co-immunoprecipitation or crosslinking studies to verify complex formation

    • Consider bacterial two-hybrid or pull-down assays to quantify interaction strength

  • Membrane integration validation:

    • Confirm proper membrane localization and topology

    • Use fractionation studies to verify membrane association

    • Employ protease protection assays to assess correct orientation

  • Standardized activity assays:

    • Develop a consistent in vitro activity assay that can be applied across systems

    • Include appropriate positive and negative controls

    • Test activity under various buffer conditions to identify optimal parameters

When researchers reported inability to detect holo-CcmE in B. japonicum while successfully detecting it in E. coli expressing B. japonicum proteins, they concluded this was likely due to expression level differences rather than fundamental functional differences . This highlights the importance of considering expression levels when comparing results across systems.

What are the major challenges in purifying functional recombinant cycZ and how can they be overcome?

Purification of functional recombinant cycZ presents several challenges due to its nature as an integral membrane protein. Key challenges and solutions include:

  • Membrane protein solubilization:

    • Challenge: Extracting cycZ from membranes while maintaining its native conformation

    • Solutions:

      • Screen multiple detergents (DDM, LMNG, digitonin) for optimal solubilization

      • Consider native nanodiscs or styrene maleic acid copolymer (SMA) approaches

      • Use mild solubilization conditions (low temperature, gentle mixing)

  • Maintaining heme association:

    • Challenge: Preserving the ability to bind and transfer heme during purification

    • Solutions:

      • Include heme or heme precursors in buffers

      • Minimize exposure to oxidizing conditions

      • Consider purification under anaerobic conditions

  • Protein stability:

    • Challenge: Preventing aggregation and denaturation during concentration steps

    • Solutions:

      • Include appropriate stabilizing agents (glycerol, specific lipids)

      • Optimize buffer composition (pH, ionic strength, specific ions)

      • Employ mild concentration techniques (dialysis against PEG rather than centrifugal concentration)

  • Functional verification:

    • Challenge: Confirming that purified protein retains native activity

    • Solutions:

      • Develop a reliable in vitro activity assay

      • Compare activity before and after each purification step

      • Consider co-purification with interaction partners

  • Low expression yield:

    • Challenge: Obtaining sufficient protein for biochemical and structural studies

    • Solutions:

      • Optimize codon usage for expression host

      • Consider fusion partners that enhance expression (MBP, SUMO)

      • Explore specialized expression strains (C41/C43 for membrane proteins)

These strategies should be combined with thorough quality control at each purification step to ensure that the final protein preparation retains its native structure and functional properties.

How can the interaction between cycZ and its partner proteins be effectively studied?

Studying interactions between cycZ and its partner proteins requires specialized approaches suitable for membrane protein complexes:

  • Co-purification strategies:

    • Express cycZ with affinity-tagged partner proteins

    • Perform tandem affinity purification to isolate intact complexes

    • Analyze complex composition by mass spectrometry

    • Verify specific enrichment compared to controls

  • Crosslinking techniques:

    • Apply chemical crosslinkers of various lengths to stabilize transient interactions

    • Use photo-crosslinking with unnatural amino acids incorporated at specific positions

    • Identify crosslinked residues by mass spectrometry to map interaction interfaces

  • Fluorescence-based approaches:

    • Förster resonance energy transfer (FRET) between fluorescently labeled proteins

    • Bimolecular fluorescence complementation (BiFC) to visualize interactions in vivo

    • Fluorescence correlation spectroscopy to measure interaction kinetics

  • Surface plasmon resonance:

    • Immobilize one partner on a sensor chip

    • Measure real-time binding and dissociation of the other partner

    • Determine binding constants and kinetic parameters

  • Genetic approaches:

    • Suppress-or studies to identify compensatory mutations

    • Bacterial two-hybrid screening to map interaction domains

    • In vivo site-specific disulfide crosslinking to validate predicted interfaces

The current model of cytochrome c maturation involves protein-protein interactions between CcmC, CcmE, and CcmD . Despite the relatively low amino acid identities between E. coli and B. japonicum proteins (45% for CcmE, 49% for CcmC, and 25% for CcmD), interactions between proteins from different species were sufficient to support cytochrome c maturation . This suggests robust interaction interfaces that can be studied using the techniques described above.

What genomic approaches could provide new insights into cycZ function across different Bradyrhizobium strains?

Comparative genomic approaches offer powerful tools for understanding cycZ function and evolution across Bradyrhizobium strains:

  • Pan-genome analysis:

    • Sequence multiple Bradyrhizobium strains with varying symbiotic capabilities

    • Identify core and accessory genes related to cytochrome c maturation

    • Correlate genome content with symbiotic efficiency

    • Search for strain-specific adaptations in the cytochrome c maturation pathway

  • Synteny analysis:

    • Compare the genomic context of cycZ across strains

    • Identify conserved gene clusters that may function together

    • Determine if cycZ is located within or near symbiosis islands in different strains

  • Population genomics:

    • Analyze single nucleotide polymorphisms in cycZ across natural populations

    • Identify signatures of selection acting on cycZ

    • Determine if cycZ shows evidence of horizontal gene transfer

  • Transcriptome profiling:

    • Compare expression patterns of cycZ and related genes across strains

    • Identify regulatory elements controlling cycZ expression

    • Determine how expression changes during symbiosis establishment

  • CRISPR-Cas9 genome editing:

    • Create precise mutations in cycZ across different strains

    • Test the effect of natural variants in standardized genetic backgrounds

    • Engineer optimized cycZ variants to enhance symbiotic efficiency

These genomic approaches would complement the experimental studies on recombinant cycZ by providing evolutionary and functional context across the diversity of Bradyrhizobium strains.

How might structural biology approaches advance our understanding of cycZ mechanism?

Structural biology approaches could significantly advance our understanding of cycZ's mechanism of action:

  • Cryo-electron microscopy:

    • Determine the structure of cycZ alone and in complex with partner proteins

    • Visualize conformational changes during the heme transfer cycle

    • Identify structural features that distinguish cycZ from homologs in other species

  • X-ray crystallography:

    • Attempt crystallization of detergent-solubilized cycZ or specific domains

    • Co-crystallize with binding partners to capture functional complexes

    • Use antibody fragments to stabilize flexible regions for crystallization

  • NMR spectroscopy:

    • Determine structures of soluble domains of cycZ

    • Study dynamics of heme binding and protein-protein interactions

    • Use solid-state NMR for full-length protein in membrane mimetics

  • Hydrogen-deuterium exchange mass spectrometry:

    • Map regions of cycZ that undergo conformational changes during function

    • Identify protected regions at protein-protein interfaces

    • Determine changes in solvent accessibility during the catalytic cycle

  • Integrative structural biology:

    • Combine low-resolution techniques (SAXS, negative-stain EM) with computational modeling

    • Use crosslinking mass spectrometry to provide distance constraints

    • Develop structural models that integrate data from multiple techniques

The integral membrane nature of cycZ makes structural studies challenging, but recent advances in membrane protein structural biology, particularly in cryo-EM, offer promising approaches for elucidating its mechanism at the molecular level.

What potential biotechnological applications could emerge from research on recombinant cycZ?

Research on recombinant cycZ could lead to several innovative biotechnological applications:

  • Enhanced symbiotic nitrogen fixation:

    • Engineer optimized cycZ variants to improve electron transport efficiency

    • Transfer engineered cytochrome c maturation systems to non-symbiotic bacteria

    • Develop biofertilizers with enhanced nitrogen fixation capabilities

  • Biocatalysis and synthetic biology:

    • Use cycZ as part of engineered heme incorporation systems for synthetic enzymes

    • Develop artificial electron transport chains for biotechnological applications

    • Create designer cytochromes with novel functionalities

  • Biosensors:

    • Develop cycZ-based biosensors for detecting heme or related compounds

    • Create reporter systems for monitoring protein-protein interactions

    • Design whole-cell biosensors for environmental monitoring

  • Protein engineering platform:

    • Use the robust nature of cycZ function across species as a model for engineering membrane proteins

    • Develop principles for designing membrane proteins with specific interaction properties

    • Create chimeric proteins with novel functionalities based on cycZ architecture

  • Therapeutic protein production:

    • Improve production of therapeutic cytochromes or heme proteins

    • Enhance expression of recombinant hemoproteins in bacterial systems

    • Develop new approaches for incorporating heme into engineered proteins

The fundamental research on cycZ and the cytochrome c maturation system provides a foundation for these applications by elucidating the molecular mechanisms of heme handling and incorporation in proteins.

How does cycZ function compare between B. japonicum and other bacterial species?

Comparative analysis of cycZ function reveals both conservation and specialization across bacterial species:

FeatureB. japonicum cycZE. coli CcmCOther species
Amino acid identityReference49% identity with B. japonicum Variable (typically 30-60%)
Functional complementationCan function in E. coli Less efficient in holo-CcmE formation than B. japonicum cycZ Species-dependent
Conserved motifsTryptophan-rich motif and flanking histidines Same conserved motifs as B. japonicum Generally conserved across species
Membrane topologyIntegral membrane protein Integral membrane protein Consistent across species
Partner proteinsInteracts with CcmE (cycJ) and CcmD Same interaction partners Conserved interaction network
Efficiency in heterologous hostMore efficient than native E. coli protein when expressed in E. coli Less efficient than B. japonicum cycZ in E. coli Variable

Despite only 49% amino acid identity between B. japonicum cycZ and E. coli CcmC, the B. japonicum protein can function in E. coli and is actually more efficient at forming holo-CcmE than the native E. coli protein . This suggests that the core functional elements of these proteins are highly conserved, while other regions may have adapted to species-specific requirements or interaction partners. The conservation of function despite sequence divergence highlights the fundamental importance of this protein in bacterial cytochrome c maturation.

What factors influence the expression and activity of recombinant cycZ in different host systems?

Multiple factors can influence the expression and activity of recombinant cycZ in heterologous host systems:

  • Codon usage optimization:

    • B. japonicum has different codon preferences than common expression hosts

    • Optimization for the host organism can significantly improve expression

    • Critical for membrane proteins that may be toxic when overexpressed

  • Membrane composition:

    • Different lipid compositions between species may affect protein folding and function

    • Consider supplementing with specific lipids or expressing in hosts with similar membrane properties

    • May influence proper topology and stability

  • Expression temperature:

    • Lower temperatures (16-25°C) often improve membrane protein folding

    • Reduces inclusion body formation

    • Slows expression rate to allow proper membrane insertion

  • Induction conditions:

    • Concentration of inducer affects expression level

    • Gradual induction may improve functional expression

    • Timing of induction relative to growth phase is important

  • Presence of partner proteins:

    • Co-expression with CcmE and CcmD may improve stability and function

    • Consider expressing the complete cytochrome c maturation system

    • Interaction partners may differ in binding affinity across species

  • Post-translational modifications:

    • Differences in protein processing between species

    • Potential differences in proteolytic processing

    • Variations in membrane insertion machinery

In experimental studies, B. japonicum cycZ was successfully expressed in E. coli using the pISC-2 expression vector, resulting in functional protein capable of inserting heme into CcmE . This suggests that despite potential challenges, functional expression of cycZ is achievable with appropriate optimization.

What controls are essential when assessing recombinant cycZ activity in experimental settings?

Robust experimental design for assessing recombinant cycZ activity requires several essential controls:

  • Positive controls:

    • Wild-type native cycZ from the expression host

    • Previously characterized cycZ variants with known activity

    • Alternative well-characterized heme transfer systems

  • Negative controls:

    • Expression vector without cycZ insert

    • Inactive cycZ variants (with mutations in conserved residues)

    • Samples without induction of cycZ expression

  • Expression verification controls:

    • Western blot confirmation of cycZ expression

    • Membrane fractionation to confirm proper localization

    • Epitope tag detection if native antibodies unavailable

  • Substrate availability controls:

    • Verification of heme availability in the system

    • Confirmation of CcmE expression levels

    • Monitoring of potential rate-limiting factors

  • System-specific controls:

    • Assessment of background cytochrome maturation in the host

    • Testing in multiple genetic backgrounds (wild-type, deletion strains)

    • Evaluation of potential compensatory mechanisms

In the research examining B. japonicum cycZ function, appropriate controls were implemented, including testing both E. coli and B. japonicum CcmC proteins in parallel, confirming equal levels of CcmE polypeptide by Western blotting, and using negative controls to verify specificity of the observed activity .

How can isotope labeling techniques enhance the study of recombinant cycZ?

Isotope labeling provides powerful tools for studying recombinant cycZ structure, interactions, and dynamics:

  • NMR spectroscopy applications:

    • 15N/13C labeling for backbone and side chain assignments

    • Selective labeling of specific amino acid types to simplify spectra

    • 2H (deuterium) labeling to reduce relaxation and improve spectra quality

    • TROSY techniques for studying large membrane protein complexes

  • Mass spectrometry applications:

    • 15N/13C labeling for precise identification of peptides

    • SILAC (Stable Isotope Labeling with Amino acids in Cell culture) for quantitative proteomics

    • Pulsed labeling to track protein synthesis and turnover rates

    • Hydrogen-deuterium exchange to map solvent-accessible regions

  • Studying protein-protein interactions:

    • Differential labeling of interaction partners to distinguish signals

    • Cross-saturation experiments to map binding interfaces

    • Isotope-edited NOESY to identify intermolecular contacts

  • Studying heme binding and transfer:

    • 57Fe-labeled heme for Mössbauer spectroscopy

    • 13C-labeled heme precursors to track heme incorporation

    • Pulse-chase experiments to measure transfer kinetics

  • In vivo studies:

    • Selective labeling of specific proteins in complex mixtures

    • Measuring synthesis and degradation rates

    • Identifying interaction networks in cellular contexts

These isotope labeling approaches can provide detailed molecular insights into cycZ function that would be difficult or impossible to obtain using other techniques, particularly for challenging membrane proteins like cycZ.

How can researchers integrate structural, functional, and evolutionary data to develop comprehensive models of cycZ action?

Developing comprehensive models of cycZ action requires sophisticated integration of diverse data types:

  • Multi-scale modeling approach:

    • Atomic-level structural models based on experimental data

    • Molecular dynamics simulations to capture dynamics and conformational changes

    • Systems biology models to place cycZ in the broader context of cytochrome maturation

    • Evolutionary models to understand selective pressures and adaptation

  • Data integration strategies:

    • Bayesian frameworks to combine probabilistic information from different sources

    • Machine learning approaches to identify patterns across diverse datasets

    • Network analysis to map functional relationships between components

    • Constraint-based modeling incorporating experimental boundaries

  • Visualization and analysis tools:

    • Interactive visualization of integrated models

    • Statistical analysis of correlations between different data types

    • Sensitivity analysis to identify critical parameters and components

    • Simulation of perturbations to test model predictions

  • Experimental validation:

    • Design experiments specifically to test model predictions

    • Iterative refinement based on new experimental data

    • Identify knowledge gaps requiring targeted investigation

    • Develop quantitative metrics for model evaluation

The current understanding of cytochrome c maturation involving CcmC, CcmE, and CcmD represents an initial model that can be expanded and refined through this integrative approach. The ability of B. japonicum cycZ to function in E. coli despite sequence divergence provides valuable constraints for understanding the essential features that must be captured in comprehensive models.

What computational approaches are most valuable for predicting effects of mutations in cycZ?

Computational prediction of mutation effects in cycZ can employ several complementary approaches:

  • Sequence-based methods:

    • Conservation analysis across homologs to identify critical residues

    • Statistical coupling analysis to detect co-evolving residues

    • Machine learning algorithms trained on known mutation effects

    • Evolutionary trace methods to identify functionally important sites

  • Structure-based methods:

    • Molecular dynamics simulations of mutant proteins

    • Free energy calculations to predict stability changes

    • Docking studies to assess effects on protein-protein interactions

    • Normal mode analysis to examine effects on protein dynamics

  • Network-based approaches:

    • Graph theoretical analysis of residue interaction networks

    • Identification of allosteric pathways that may be disrupted

    • Prediction of mutation effects on global protein properties

    • Integration of multi-scale models to capture system-level effects

  • Specialized tools for membrane proteins:

    • Prediction of effects on membrane insertion and topology

    • Assessment of hydrophobic mismatch with the lipid bilayer

    • Evaluation of impacts on lateral organization within membranes

    • Analysis of effects on protein-lipid interactions

  • Validation and refinement:

    • Retrospective analysis of previous mutation data

    • Prospective testing of computational predictions

    • Iterative improvement of prediction algorithms

    • Development of cycZ-specific prediction parameters

For cycZ, mutation analysis should focus particularly on the conserved tryptophan-rich motif and flanking histidines implicated in heme handling , as well as residues at interfaces with partner proteins CcmE and CcmD.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.