Recombinant Bradyrhizobium japonicum Large-conductance mechanosensitive channel (mscL)

Shipped with Ice Packs
In Stock

Description

Functional Properties and Gating

MscL channels sense bilayer tension, enabling rapid ion efflux during osmotic downshock. Functional studies on homologs reveal:

PropertyDescriptionSource
Conductance~3 nS in the open state, allowing passage of small ions (e.g., K⁺, Na⁺).
Gating ThresholdRequires membrane tension >10 mN/m to open; sensitivity varies by species.
InhibitorsGadolinium (Gd³⁺) blocks the pore; lipophilic compounds (e.g., DHS) modulate gating.
Physiological RoleMaintains cytoplasmic osmolarity, prevents lysis under hypotonic stress.

For B. japonicum, MscL may contribute to survival in fluctuating soil osmolarity, though its specific role in symbiosis with soybeans remains unstudied.

Recombinant Production and Functional Reconstitution

Recombinant MscL is typically expressed in heterologous systems (e.g., E. coli) and purified for structural or functional analysis:

StepMethodSource
CloningPCR-amplified mscL gene inserted into expression vectors (e.g., pET, pVK).
ExpressionInduced in E. coli under optimized conditions (e.g., 16–25°C, IPTG induction).
PurificationSolubilization with detergents (e.g., DDM), affinity chromatography, gel filtration.
ReconstitutionPurified protein incorporated into artificial liposomes or bilayers.

Functional validation via patch-clamp electrophysiology confirms channel activity, as demonstrated for E. coli MscL . For B. japonicum, similar protocols could be adapted, though strain-specific optimization may be required.

Applications and Research Gaps

While recombinant B. japonicum MscL has not been extensively studied, its homologs provide insights into potential uses:

ApplicationDescriptionSource
Antimicrobial TargetsMscL-specific inhibitors (e.g., ramizol) disrupt bacterial membranes.
Biotechnological ToolsUsed as nanopores for DNA sequencing or biosensing.
Stress Response ModelsStudy osmoprotection in rhizobia during symbiosis or soil stress.

Gaps:

  • No direct studies on B. japonicum MscL’s role in symbiosis or stress adaptation.

  • Limited data on its interaction with soybean-derived compounds (e.g., isoflavonoids).

  • Genome-wide analyses of B. japonicum (e.g., DSM 30131) have not prioritized mechanosensitive channels .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
If you require a specific tag, please inform us; we will prioritize development accordingly.
Synonyms
mscL; bll5071; Large-conductance mechanosensitive channel
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-138
Protein Length
full length protein
Species
Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110)
Target Names
mscL
Target Protein Sequence
MLKEFREFAMKGNVVDLAVGVIIGAAFGAIVTSLVGDVIMPLIGAVTGGLDFSNYFTPLS KAVTATNLADAKKQGAVLAWGSFLTLTINFIIIAFVLFLVIRAINTLKRKEEAAPAAPPK PSAEVELLTEIRDLLKKS
Uniprot No.

Target Background

Function
A mechanosensitive channel that opens in response to membrane lipid bilayer stretch forces. It may play a role in regulating intracellular osmotic pressure changes.
Database Links

KEGG: bja:bll5071

STRING: 224911.bll5071

Protein Families
MscL family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Bradyrhizobium japonicum and why is its MscL channel significant for research?

Bradyrhizobium japonicum is a Gram-negative soil bacterium that establishes a symbiotic relationship with soybean plants, allowing nitrogen fixation and conversion of atmospheric nitrogen into ammonia . The large-conductance mechanosensitive channel (MscL) in B. japonicum is particularly significant as it represents a critical component in bacterial osmoregulation and survival during osmotic stress conditions. This channel opens in response to mechanical forces in the lipid bilayer, which are generated during osmotic downshock, preventing cell lysis .

The study of B. japonicum MscL provides valuable insights into both fundamental membrane biophysics and the specific adaptations of symbiotic nitrogen-fixing bacteria. Unlike many other microorganisms, B. japonicum has distinctive growth characteristics (slow growth) and environmental adaptations that make its MscL potentially unique in terms of gating properties, expression patterns, and physiological role .

What are the optimal conditions for expressing recombinant B. japonicum MscL in E. coli expression systems?

Effective expression of recombinant B. japonicum MscL in E. coli requires careful optimization of several parameters:

  • Expression System Selection: The recombinant protein is commonly expressed in E. coli with N-terminal His-tag fusion for purification purposes .

  • Growth Conditions: For optimal expression:

    • Culture media: Typically LB or rich media supplemented with appropriate antibiotics

    • Temperature: Lower temperatures (16-25°C) after induction often improve proper folding of membrane proteins

    • Induction: IPTG concentration between 0.1-0.5 mM, with induction at mid-log phase (OD600 ~0.6-0.8)

    • Duration: 4-6 hours at 37°C or overnight at lower temperatures

  • Strain Selection: BL21(DE3), C41(DE3), or C43(DE3) strains are recommended as they are engineered for membrane protein expression.

  • Codon Optimization: Since B. japonicum has different codon usage compared to E. coli, codon optimization of the mscL gene may significantly improve expression yields.

It's important to note that as a membrane protein, MscL expression can be challenging and may require testing multiple conditions to achieve optimal results. Monitoring expression through small-scale trials before scaling up is recommended .

What purification strategy yields the highest purity and functional integrity of recombinant B. japonicum MscL?

A systematic purification strategy for recombinant B. japonicum MscL that maintains both purity and functional integrity involves:

  • Membrane Fraction Isolation:

    • Cell lysis via French press, sonication, or detergent-based methods

    • Differential centrifugation to isolate membrane fractions (typically 100,000×g ultracentrifugation)

  • Solubilization:

    • Selection of appropriate detergents (DDM, LDAO, or C12E8) at concentrations above their critical micelle concentration

    • Gentle solubilization with slow stirring at 4°C for 1-2 hours

  • Affinity Chromatography:

    • Ni-NTA purification utilizing the His-tag

    • Washing with low imidazole concentrations (20-40 mM)

    • Elution with higher imidazole (250-300 mM)

  • Secondary Purification:

    • Size exclusion chromatography to remove aggregates

    • Ion exchange chromatography for further purification if needed

  • Quality Control:

    • SDS-PAGE analysis with expected molecular weight of approximately 15 kDa per monomer

    • Western blotting with anti-His antibodies

    • Size exclusion chromatography to confirm pentameric assembly

For functional studies, it's crucial to maintain the protein in a suitable detergent environment or reconstitute it into liposomes. The buffer composition typically includes Tris/PBS-based buffer at pH 8.0, and 6% trehalose can be added as a stabilizing agent for storage .

What electrophysiological techniques are most effective for characterizing the conductance properties of B. japonicum MscL?

The electrophysiological characterization of B. japonicum MscL channels requires specialized techniques that can detect and measure channel activity in response to membrane tension:

  • Patch-Clamp Electrophysiology:

    • Inside-out excised patch configuration is the gold standard for MscL characterization

    • Negative pressure application via a pressure clamp system to generate membrane tension

    • Recording parameters: +20 mV holding potential in 200 mM KCl solution is standard for initial characterization

    • Expected single-channel conductance: Based on other bacterial MscL channels, expected conductance is approximately 3-3.5 nS in physiological conditions

  • Planar Lipid Bilayer Recordings:

    • Enables control of lipid composition and membrane properties

    • Allows for studying the influence of specific lipids on channel gating

  • Pressure-to-Channel Opening Ratio Measurements:

    • The ratio between the pressure needed to open MscL and reference channels (like MscS) provides a normalized measure of tension sensitivity

    • This ratio is conventionally reported as P₁/₂ MscL : P₁/₂ MscS

Studies should include pressure-response curves to determine the gating threshold and measure channel kinetics (opening and closing rates) at different membrane tensions. For comparative analysis, channels like MscS, with lower gating tensions, can serve as useful references .

How can researchers effectively reconstitute recombinant B. japonicum MscL into liposomes for functional studies?

Successful reconstitution of B. japonicum MscL into liposomes for functional studies involves a multi-step process:

  • Lipid Selection and Preparation:

    • Common lipid mixtures include POPE:POPG (7:3) or E. coli polar lipid extract

    • Lipids are dissolved in chloroform, dried into a thin film, and rehydrated in reconstitution buffer

    • Sonication or extrusion through polycarbonate filters (typically 400 nm) to form unilamellar vesicles

  • Protein-Lipid Mixture Preparation:

    • Detergent-solubilized protein is mixed with liposomes at protein:lipid ratios between 1:50 and 1:2000 (w/w)

    • For MscL studies, 1:200 to 1:500 protein:lipid ratios are often optimal

  • Detergent Removal:

    • Bio-Beads SM-2 adsorption (most common method)

    • Dialysis against detergent-free buffer

    • Removal rate must be controlled—too rapid removal can cause protein aggregation

  • Verification of Reconstitution:

    • Freeze-fracture electron microscopy to visualize protein incorporation

    • Sucrose density gradient centrifugation to separate proteoliposomes from empty liposomes

    • Fluorescence-based assays to verify channel function

  • Functional Verification:

    • Fluorescence-based osmotic shock assays using calcein release

    • Stopped-flow spectroscopy to measure water or solute flux

This reconstitution approach, based on the well-established "force-from-lipids" principle, allows researchers to examine how bilayer properties affect MscL gating dynamics, including the effects of membrane thickness, stiffness, and specific lipid components .

How is the expression of MscL regulated in B. japonicum under different environmental conditions?

The expression of MscL in B. japonicum, like in other bacteria, is regulated in response to environmental stressors and growth conditions:

The regulation of MscL in B. japonicum reflects its evolutionary adaptation to survive in fluctuating soil environments while maintaining the capacity to enter into symbiotic relationships with host plants. This dual lifestyle likely influences the expression patterns of stress-response proteins like MscL .

What is the relationship between MscL expression and nodulation efficiency in the B. japonicum-soybean symbiosis?

The relationship between MscL expression and nodulation efficiency in the B. japonicum-soybean symbiosis represents an intriguing but underexplored area of research. Based on current understanding:

  • Osmoregulation During Nodule Formation:

    • During the infection process, bacteria must adapt to changing osmotic conditions as they transition from soil to infection thread to symbiosome

    • MscL likely plays a role in this adaptation, potentially affecting the efficiency of nodule establishment

  • Nodulation Timing and Development:

    • Studies have shown that mutations in certain B. japonicum genes can cause delayed nodulation without affecting the final number of nodules

    • The role of mechanosensitive channels in this process remains to be fully characterized

  • Connection to Motility and Biofilm Formation:

    • Research has demonstrated that certain transcription factors (like MocR) can simultaneously affect motility, biofilm formation, and nodulation timing

    • Given that MscL responds to membrane tension, which is also affected by cell shape changes during motility, there may be indirect relationships between MscL function and these processes

  • Correlation with Nodulation Efficiency Factors:

    FactorEffect on MscLPotential Impact on Nodulation
    Soil salinityIncreased expressionMay enhance osmotic tolerance during infection
    pH variationsAltered functionalityCould affect survival in infection thread environment
    Nutrient availabilityModified regulationMay influence competition for nodulation sites

The full understanding of how MscL expression patterns influence symbiotic performance requires further research, potentially using strain-specific gene expression studies combined with nodulation assays under various environmental conditions .

What strategies are effective for creating site-directed mutations in B. japonicum MscL for structure-function studies?

Creating site-directed mutations in B. japonicum MscL requires tailored approaches due to the bacterium's slow growth and high incidence of spontaneous antibiotic resistance. Effective strategies include:

  • Rapid Selection Method for Recombinant Mutants:

    • Using antibiotic cassettes (kanamycin or spectinomycin) to replace DNA fragments in the chromosome via homologous recombination

    • Implementing plate selection for antibiotic-resistant mutants followed by colony streaking

    • Direct identification via DNA hybridization on nitrocellulose filters without the need to first isolate genomic DNA from each mutant

  • Target Selection for Structure-Function Studies:

    • Transmembrane domains: Mutations affecting hydrophobic interactions with the lipid bilayer

    • Channel constriction site: Modifications of residues forming the hydrophobic gate

    • C-terminal domain: Alterations affecting channel stability and assembly

  • Vector Design Considerations:

    • Including at least 500-1000 bp homology regions flanking the target site

    • Using broad-host-range vectors capable of replication in B. japonicum

    • Incorporating counterselectable markers for efficient screening

  • Transformation Methods:

    • Electroporation protocols optimized for B. japonicum

    • Conjugation using E. coli donor strains

    • Optimizing conditions to overcome the thick exopolysaccharide layer of B. japonicum

  • Phenotypic Characterization:

    • Osmotic shock survival assays to assess channel functionality

    • Electrophysiological measurements to determine changes in channel properties

    • Protein expression and localization studies to confirm proper assembly

This methodological approach allows researchers to create specific mutations for investigating critical residues involved in tension sensing, gating, and ion conductance in the B. japonicum MscL channel .

How can researchers differentiate between the functions of MscL and other mechanosensitive channels in B. japonicum?

Differentiating between the functions of MscL and other mechanosensitive channels in B. japonicum requires a multi-faceted approach:

  • Genetic Deletion and Complementation:

    • Creating single and multiple mechanosensitive channel deletion strains

    • Complementation with channel-specific genes to confirm phenotypic restoration

    • Utilizing the methodology developed for rapid selection of recombinant site-directed mutants

  • Electrophysiological Characterization:

    • Patch-clamp analysis to differentiate channels based on conductance properties:

      • MscL typically shows large conductance (approximately 3 nS)

      • Other channels like MscS, MscK, and MscM show distinct conductance values and gating characteristics

    • Channel-specific signatures in terms of current amplitude and gating kinetics

  • Osmotic Challenge Assays:

    • Exposing deletion mutants to various magnitudes of osmotic downshock

    • Quantifying survival rates to determine the contribution of each channel

    • Comparing the behavior of B. japonicum channels to the established hierarchy in E. coli (MscM → MscS → MscK → MscL)

  • Expression Analysis Under Different Conditions:

    • Using fluorescent protein fusions to monitor channel expression

    • Examining differential expression patterns in response to various stresses

    • Determining if channels are co-regulated or independently controlled

  • Channel Conductance Comparison Table:

    Channel TypeApproximate ConductanceGating PressureKey Distinguishing Features
    MscL90 pA (at 20 mV, 200 mM KCl)HighestLarge conductance, late gating
    MscS25 pAIntermediateMedium conductance, specific inactivation properties
    MscK17.5 pAIntermediateSimilar to MscS but potassium dependent
    YnaI~2 pALowerVery small conductance
    YbiO/YjeP5-8 pALowerMultiple conductance states

This methodological framework enables researchers to distinguish the unique contributions of each mechanosensitive channel to B. japonicum's osmotic stress response and potentially to its symbiotic lifestyle .

How can B. japonicum MscL be utilized in biosensor development for agricultural applications?

Utilizing B. japonicum MscL in biosensor development for agricultural applications represents an innovative frontier with several promising approaches:

  • Soil Osmotic Stress Monitoring:

    • Engineering MscL-based biosensors that respond to osmotic stress in agricultural soils

    • Coupling MscL gating to reporter systems (fluorescent proteins, electrochemical signals)

    • Creating devices that can provide early warning of soil salinity issues affecting rhizobial populations

  • Root Nodule Formation Assessment:

    • Developing biosensors that monitor the osmotic conditions during nodule formation

    • Creating diagnostic tools to evaluate the efficiency of the symbiotic process

    • Using MscL-reporter fusions to visualize bacterial adaptation during the infection process

  • Methodology for Biosensor Development:

    • Channel engineering: Modifying the gating threshold of MscL through targeted mutations

    • Reporter coupling: Linking channel opening to calcium influx or other secondary messenger systems

    • Signal amplification: Incorporating enzymatic cascades activated by initial MscL gating events

  • Implementation Strategies:

    • Encapsulation of engineered bacteria in alginate beads for field deployment

    • Integration with microfluidic devices for high-throughput screening

    • Combination with wireless reporting systems for real-time monitoring

  • Potential Applications in Inoculant Development:

    • Quality control of commercial B. japonicum inoculants through stress resistance profiling

    • Selection of strains with optimal MscL expression patterns for enhanced survival

    • Development of stress-tolerant strains through targeted MscL modifications

The development of such biosensors could significantly advance precision agriculture by providing real-time information about soil conditions affecting rhizobial populations and symbiotic nitrogen fixation efficiency .

What is the potential role of MscL in improving B. japonicum survival during inoculant production and application?

The large-conductance mechanosensitive channel (MscL) plays a critical role in bacterial survival during osmotic challenges, suggesting several strategies for improving B. japonicum inoculant technology:

  • Inoculant Production Optimization:

    • Controlled upregulation of MscL expression during production to create more stress-resistant cultures

    • Implementing pre-conditioning regimes that induce protective mechanisms including MscL expression

    • Optimizing growth media composition to enhance membrane protein expression and stability

  • Formulation Enhancements:

    • Incorporating osmoprotectants that stabilize cell membranes during drying processes

    • Using encapsulation techniques with defined sucrose concentrations (1-3%) that maintain MscL functionality

    • Viability studies show that B. japonicum encapsulated in sodium alginate with 1-3% sucrose can remain viable for over 190 days, while higher concentrations (5-10%) reduce long-term viability

  • Storage and Application Considerations:

    • Developing storage conditions that maintain MscL in a functional state

    • Creating application methodologies that minimize osmotic shock during soil introduction

    • Formulating carrier materials that provide gradual rehydration in field conditions

  • Strain Selection and Engineering:

    • Screening for natural B. japonicum variants with enhanced MscL expression or functionality

    • Engineering strains with modified MscL properties to improve survival during production and storage

    • Developing strains with tuned mechanosensitive channel expression profiles

  • Quality Control Methodologies:

    • Implementing selective media for B. japonicum that can assess viable counts before application

    • Using the Bradyrhizobium selective medium (BJSM) for quality assessment of commercial inoculants

    • Data shows that BJSM plate counting results are comparable to plant infection most-probable-number (MPN) assays for quantifying viable B. japonicum

These approaches could significantly improve the efficiency of biological nitrogen fixation in agriculture by enhancing the survival and establishment of B. japonicum inoculants in field conditions .

What are the major challenges in distinguishing B. japonicum MscL from other bacterial MscL channels in heterologous expression systems?

Distinguishing B. japonicum MscL from other bacterial MscL channels in heterologous expression systems presents several methodological challenges with specific solutions:

  • Sequence Homology and Structural Similarity Challenges:

    • MscL channels share conserved domains across bacterial species

    • Solution: Develop antibodies against unique epitopes in the B. japonicum MscL sequence

    • Implementation: Target variable regions in the C-terminal domain for antibody generation

  • Functional Characterization Issues:

    • Similar conductance properties across bacterial MscL channels

    • Solution: Detailed pressure-response profiles and kinetic analysis

    • Implementation: Compare gating thresholds and kinetics across different MscL channels under identical conditions

  • Expression Level Variability:

    • Different expression efficiencies in heterologous systems

    • Solution: Quantitative Western blotting with calibrated standards

    • Implementation: Use purified B. japonicum MscL protein as a standard

  • Background Channel Activity:

    • Endogenous mechanosensitive channels in expression hosts

    • Solution: Use MscL-null E. coli strains (strain MJF641 lacking all seven mechanosensitive channels)

    • Implementation: Prepare membrane patches from these specialized bacterial strains

  • Comparative Electrophysiological Characteristics:

    ParameterB. japonicum MscLE. coli MscLMethod of Differentiation
    Gating thresholdSpecies-specificWell-characterizedPressure ratio measurement
    Conductance~3 nS (estimated)3-3.5 nSSingle-channel recording
    Inactivation kineticsTo be determinedWell-characterizedExtended recording protocols
    pH sensitivitySpecies-specificWell-characterizedpH titration experiments
  • Tagging Interference:

    • His-tag effects on channel properties

    • Solution: Compare tagged and untagged versions, or use cleavable tags

    • Implementation: Include TEV protease sites for tag removal after purification

These methodological approaches enable researchers to distinguish the unique properties of B. japonicum MscL despite the high conservation of mechanosensitive channel structure and function across bacterial species .

How can researchers overcome the challenges associated with the slow growth of B. japonicum in experimental designs?

The slow growth characteristics of Bradyrhizobium japonicum present significant challenges for research, requiring specialized approaches to maintain experimental efficiency:

  • Culture Optimization Strategies:

    • Media enhancement: Using rich media specifically formulated for B. japonicum growth

    • Temperature optimization: Maintaining cultures at 28±2°C for optimal growth

    • Growth acceleration: Supplementing media with factors that promote faster growth while maintaining cellular physiology

    • Implementation timeline: Allow 3-5 days for individual colonies to develop and 7-9 days for dense cultures in liquid media

  • Genetic Manipulation Approaches:

    • Shuttle vector systems: Use broad-host-range vectors that can be manipulated in E. coli

    • Rapid selection methods: Implement the technique developed for quick identification of recombinant site-directed mutants

    • Selection optimization: Utilize the high natural resistance to zinc and cobalt (>40 μg/ml) as selective markers

    • Streamlined protocols: Direct identification using colony hybridization without genomic DNA isolation

  • Experimental Design Considerations:

    • Parallel processing: Working with multiple experimental setups simultaneously

    • Staggered timelines: Planning experiments to account for the slow growth cycle

    • Control strain selection: Using faster-growing rhizobial strains as preliminary controls

    • Establishing realistic timeframes: Planning 3-4 weeks for experiments that might require only days with faster-growing organisms

  • Selective Media Utilization:

    • Using Bradyrhizobium selective medium (BJSM) for isolation and enumeration

    • BJSM composition: AG medium supplemented with 1.0 μg/ml Brilliant Green, 500 μg/ml PCNB, 83 μg/ml ZnCl₂, and 88 μg/ml CoCl₂

    • Growth characteristics: B. japonicum forms white colonies on congo-red yeast extract mannitol agar medium

    • Differentiation: On YEMA supplemented with bromothymol blue, slow-growing bradyrhizobia turn the medium blue, while fast-growing rhizobia turn it yellow

  • Long-term Storage Solutions:

    • Immobilization techniques: Encapsulation in sodium alginate beads with 1-3% sucrose

    • Viability preservation: Maintains culture viability for over 190 days at room temperature

    • Resuscitation protocols: Optimized procedures for recovering cultures from storage

By implementing these specialized methodologies, researchers can overcome the inherent challenges of B. japonicum's slow growth while maintaining experimental rigor and reliability .

What emerging technologies might advance our understanding of B. japonicum MscL function in symbiotic relationships?

Several cutting-edge technologies hold promise for deepening our understanding of B. japonicum MscL function in symbiotic relationships:

  • Advanced Imaging Technologies:

    • Super-resolution microscopy to visualize MscL distribution during different stages of symbiosis

    • Light sheet microscopy for real-time imaging of bacteria during infection thread formation

    • Cryo-electron microscopy to obtain high-resolution structures of B. japonicum MscL in different conformational states

  • Single-Cell and Single-Molecule Techniques:

    • Single-cell RNA sequencing to profile MscL expression in individual bacteroids within nodules

    • FRET-based tension sensors to monitor membrane tension during symbiotic stages

    • Single-molecule force spectroscopy to measure MscL gating dynamics in native-like membranes

    • Single-cell census approaches similar to those used in E. coli MscL studies to quantify expression variability

  • Genome Editing and Synthetic Biology:

    • CRISPR-Cas9 systems optimized for B. japonicum to create precise modifications in MscL

    • Synthetic genetic circuits to control MscL expression under specific symbiotic conditions

    • Biosensors that report on MscL activation during the infection process

  • Computational and Systems Biology Approaches:

    • Molecular dynamics simulations of B. japonicum MscL in membranes with plant-derived lipids

    • Systems biology models integrating MscL function with other aspects of symbiotic nitrogen fixation

    • Comparative genomics across highly reiterated sequence-possessing (HRS) B. japonicum isolates, which have shown slower growth but maintained symbiotic properties

  • Multi-omics Integration:

    • Proteomics to identify interacting partners of MscL during symbiosis

    • Metabolomics to assess changes in bacterial metabolism related to MscL function

    • Lipidomics to characterize membrane composition changes during nodule formation

These technological advances will help bridge the gap between molecular understanding of MscL function and its role in the complex biological process of establishing and maintaining the B. japonicum-soybean symbiosis .

How might climate change factors influence the role of MscL in B. japonicum adaptation and symbiotic efficiency?

Climate change presents multiple stressors that may significantly impact the role of MscL in B. japonicum adaptation and symbiotic efficiency:

  • Temperature Fluctuations:

    • Rising temperatures may alter membrane fluidity and consequently MscL gating properties

    • Research methodologies: Compare MscL function in B. japonicum grown at different temperatures (5-45°C)

    • Projected impact: Temperature extremes may require adaptive responses in MscL expression or structure to maintain optimal tension sensitivity

  • Drought and Soil Moisture Variability:

    • Increased frequency of drought will expose soil bacteria to more severe osmotic challenges

    • Research approaches: Examine MscL expression under varying soil moisture conditions using quantitative proteomics

    • Functional significance: Enhanced MscL expression may become a critical survival factor under drought conditions

  • Soil Salinity Increases:

    • Rising sea levels and changing precipitation patterns may increase soil salinity

    • Experimental design: Test B. japonicum strains with modified MscL expression under various NaCl concentrations (1-4%)

    • Current findings: B. japonicum can tolerate 1% and 2% NaCl but shows reduced growth at higher concentrations

  • CO₂ Concentration Effects:

    • Elevated atmospheric CO₂ alters plant physiology and root exudate composition

    • Research questions: How do changing root exudates influence bacterial membrane composition and MscL function?

    • Methodological approach: Expose B. japonicum to root exudates from plants grown under ambient vs. elevated CO₂

  • Interactive Stress Effects on Symbiosis:

    Climate FactorEffect on MscLImpact on SymbiosisAdaptation Strategy
    Heat stressAltered gating thresholdDelayed nodulationModified expression regulation
    DroughtIncreased expressionReduced infection successEnhanced osmotic protection
    SalinityModified lipid interactionChanged competitive abilityStrain selection for salinity tolerance
    Extreme weather eventsAcute osmotic challengesDisrupted establishmentSelection for rapid response variants
  • Mitigation Strategies:

    • Development of climate-resilient B. japonicum strains with optimized MscL expression profiles

    • Encapsulation technologies that provide additional protection against environmental stressors

    • Inoculant formulations with osmoprotectants that stabilize membranes under stress conditions

Understanding these interactions will be crucial for developing effective rhizobial inoculants that can maintain symbiotic nitrogen fixation efficiency under changing climate conditions, ultimately supporting sustainable agricultural systems .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.