Recombinant Bradyrhizobium japonicum Probable intracellular septation protein A (bll0472)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Bradyrhizobium japonicum Probable Intracellular Septation Protein A (bll0472)

Recombinant Bradyrhizobium japonicum Probable intracellular septation protein A (bll0472) is a protein derived from Bradyrhizobium japonicum (sometimes classified as Bradyrhizobium diazoefficiens), a gram-negative soil bacterium known for its nitrogen-fixing symbiotic relationship with legume plants. The protein is encoded by the bll0472 gene and has been identified as a probable intracellular septation protein based on sequence homology with similar proteins in other bacterial species .

The term "recombinant" indicates that this protein is produced through genetic engineering techniques, typically involving the insertion of the bll0472 gene into a host organism for expression and subsequent purification. This approach allows for the production of significant quantities of the protein for research purposes while maintaining its structural and functional properties. As suggested by its name, the protein likely plays a role in bacterial cell division processes, specifically in the formation of the septum that divides a bacterial cell into two daughter cells during reproduction .

Given the challenges associated with studying membrane proteins in their native environment, the availability of recombinant bll0472 provides researchers with a valuable tool for investigating bacterial cell division mechanisms and potential applications in biotechnology and agriculture. The protein belongs to the YciB family of inner membrane proteins, which are known to be involved in cell division processes across various bacterial species .

Expression Systems

The recombinant production of bll0472 protein is primarily carried out in E. coli expression systems, as indicated in the product information from multiple sources . This approach offers several advantages for protein production, including rapid growth of the host organism, high protein yields, and well-established protocols for induction and harvesting. The gene encoding bll0472 is typically cloned into an expression vector that includes regulatory elements for controlled protein expression and a sequence encoding a His-tag for purification purposes.

Due to the hydrophobic nature of bll0472, expression in E. coli may face challenges similar to those encountered with other membrane proteins. These challenges may include toxicity to the host cells, inclusion body formation, or low expression levels. To address these issues, specialized E. coli strains, optimized growth conditions, and carefully controlled induction parameters are typically employed to enhance the yield and quality of the recombinant protein .

Table 1: Expression Parameters for Recombinant bll0472 Production

ParameterTypical ConditionsNotes
Host OrganismE. coliCommon laboratory strain for protein expression
Expression RegionFull Length (1-200)Encompasses the entire protein sequence
TagHisN-terminal His-tag for purification
Expression VectorNot specified in resultsLikely uses T7 or similar promoter system
Product FormLyophilized powderFor stable long-term storage
Purity>90%As determined by SDS-PAGE

Purification Methods

The purification of recombinant bll0472 protein leverages the His-tag affinity purification method . This approach involves several key steps to isolate the protein from the E. coli expression system:

First, the bacterial cells expressing the protein are harvested and lysed to release the cellular contents. The lysate is then clarified by centrifugation and/or filtration to remove cell debris and insoluble components. The clarified lysate is subjected to affinity chromatography using a nickel-nitrilotriacetic acid (Ni-NTA) resin or similar matrix that specifically binds the His-tagged protein .

After the protein binds to the affinity resin, a series of washing steps removes non-specifically bound proteins and contaminants. The purified bll0472 protein is then eluted from the resin using a buffer containing imidazole, which competes with the His-tag for binding to the nickel ions. The eluted protein may undergo additional purification steps, such as size exclusion chromatography, to further enhance its purity.

Given the hydrophobic nature of bll0472, specialized detergents or buffer systems may be incorporated into the purification process to maintain protein solubility and prevent aggregation. The final product typically achieves greater than 90% purity as determined by SDS-PAGE analysis .

Comparative Analysis with Homologous Proteins

A comparative analysis between bll0472 from Bradyrhizobium japonicum and ispA from Shigella flexneri reveals several notable similarities and potential functional parallels. Both proteins are small (approximately 21 kDa), highly hydrophobic, and likely localized to the bacterial inner membrane . These shared characteristics suggest conservation of function across different bacterial species, highlighting the evolutionary importance of these proteins in bacterial cell biology.

The ispA gene in Shigella has been sequenced and found to be equivalent to a previously uncharacterized gene of Escherichia coli located between trp and tonB . This genetic context provides additional insights into the evolutionary relationships between these homologous proteins and their potential roles in different bacterial species.

Table 2: Comparison of bll0472 with Homologous Proteins

Characteristicbll0472 (B. japonicum)ispA (S. flexneri)
Protein Size200 amino acids, ~21 kDa~21 kDa
HydrophobicityVery hydrophobicVery hydrophobic
Cellular LocationPredicted inner membraneInner membrane
FunctionProbable intracellular septationIntracellular septation, virulence
Effect of MutationNot specified in resultsDefects in cell division, filamentous growth
Associated ProcessesCell division (predicted)Cell division, actin polymerization, virulence

This comparative analysis suggests that bll0472 and ispA share not only structural similarities but also likely functional roles in their respective bacterial species. The essential nature of ispA for proper cell division and virulence in Shigella indicates that bll0472 may play equally important roles in Bradyrhizobium japonicum's cellular processes and potentially in its symbiotic relationship with legume plants.

Current Research Applications

Recombinant bll0472 protein is primarily used for research purposes, enabling scientists to investigate bacterial cell division mechanisms and related cellular processes. The availability of purified recombinant protein facilitates various experimental approaches, including:

  1. Structural studies to determine the three-dimensional conformation of the protein

  2. Functional assays to investigate the protein's role in septum formation

  3. Development of antibodies for detection and localization studies

  4. Protein-protein interaction analyses to identify binding partners

  5. Comparative studies across different bacterial species

These research applications contribute to our understanding of fundamental bacterial cell biology and may lead to insights with broader implications for biotechnology, agriculture, and medicine .

Potential Biotechnological Applications

Beyond basic research, bll0472 and related proteins may have potential applications in biotechnology and agriculture, particularly in relation to Bradyrhizobium japonicum's role in nitrogen fixation. As a symbiotic nitrogen-fixing bacterium, Bradyrhizobium japonicum forms nodules on the roots of legume plants, where it converts atmospheric nitrogen into forms that plants can use.

Understanding the cell division mechanisms of this bacterium, including the role of bll0472, may provide opportunities for enhancing symbiotic relationships and improving nitrogen fixation efficiency. This could have significant implications for sustainable agriculture by reducing the need for chemical fertilizers and enhancing plant growth.

Additionally, insights into bacterial cell division mechanisms may contribute to the development of novel antimicrobial strategies targeting essential cell division proteins. While not directly indicated in the search results, the essential nature of homologous proteins like ispA in other bacterial species suggests that bll0472 may represent a potential target for controlling bacterial growth or modulating specific bacterial behaviors.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
Tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
yciB; bll0472; Inner membrane-spanning protein YciB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-200
Protein Length
full length protein
Species
Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110)
Target Names
bll0472
Target Protein Sequence
MDKTQPHPLFKLATELGPLLVFFFVNAKFNLFAATGAFMVAIVAAMIASYVVTRHIPIMA IVTGVIVLVFGTLTLVLHDETFIKVKPTIIYGLFAAILGGGLLFGRSFIAVMFDQMFNLT PQGWRILTLRWALFFAGMAVLNEIVWRTQSTDFWVNFKVFGVTPITMIFAIAQMPLTKRY HLEPVSLEASEADAGDVRKG
Uniprot No.

Target Background

Function

This protein plays a crucial role in cell envelope biogenesis, maintaining cell envelope integrity and membrane homeostasis.

Database Links

KEGG: bja:bll0472

STRING: 224911.bll0472

Protein Families
YciB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the probable intracellular septation protein A (bll0472) in Bradyrhizobium japonicum?

The bll0472 gene encodes a probable intracellular septation protein in Bradyrhizobium japonicum, a nitrogen-fixing soil bacterium that forms symbiotic relationships with leguminous plants, particularly soybeans. Based on comparative genomic analysis, this protein likely shares functional similarities with the ispA (intracellular septation) protein found in other bacteria such as Shigella flexneri. In these bacteria, intracellular septation proteins play crucial roles in cell division processes, particularly in septum formation during bacterial replication . The protein is predicted to be relatively small (approximately 21 kDa) and highly hydrophobic, suggesting membrane association or integration, which aligns with its putative role in cell division mechanics .

How is bll0472 positioned within the genomic structure of Bradyrhizobium japonicum?

The bll0472 gene is located within the complete genome sequence of Bradyrhizobium japonicum. According to genomic mapping, it is positioned among a cluster of genes (bll0464-bll0480) on the chromosome, as documented in the complete genomic sequencing studies . This genomic region contains multiple genes with diverse predicted functions, including several with roles in cellular processes. The nomenclature "bll" typically indicates genes encoded on the leading strand of the chromosome, as opposed to "blr" genes on the lagging strand, providing insight into the transcriptional organization of this genomic region .

What experimental evidence supports the predicted function of bll0472?

While direct experimental evidence specifically for bll0472 in B. japonicum is limited in the available literature, functional predictions are derived from homology with better-characterized septation proteins in related bacteria. In Shigella flexneri, mutagenesis studies demonstrated that disruption of the homologous ispA gene resulted in cell division defects, producing elongated filamentous bacteria lacking proper septation . Mutants showed initial normal intercellular spread followed by a gradual reduction in spreading capabilities within epithelial cell monolayers, ultimately leading to bacterial entrapment within host cells . The complementation of these defects through reintroduction of the functional gene confirmed its essential role in septation processes. Similar experimental approaches would be valuable for confirming the analogous function of bll0472 in B. japonicum.

What are the recommended protocols for cloning and expressing recombinant bll0472?

For successful cloning and expression of recombinant bll0472, the following methodological approach is recommended:

Cloning Strategy:

  • Primer Design: Design primers that incorporate appropriate restriction sites compatible with your expression vector. Consider the following parameters:

    • Tm values between 55-65°C

    • GC content between 40-60%

    • Addition of 6-9 extra bases upstream of restriction sites

    • Potential inclusion of an N-terminal tag to enhance protein solubility

  • PCR Amplification: Extract genomic DNA from B. japonicum using standard methods (e.g., phenol-chloroform extraction). Perform PCR using high-fidelity polymerase to minimize mutation risk. Recommended thermal cycling conditions:

    • Initial denaturation: 95°C for 3 minutes

    • 30-35 cycles of: 95°C for 30 seconds, 58°C for 30 seconds, 72°C for 1 minute

    • Final extension: 72°C for 10 minutes

  • Vector Selection: Due to the hydrophobic nature of the protein (as observed in homologous proteins like ispA), consider these expression systems :

    • pET-based vectors for high-level expression

    • pMAL-c2X for enhanced solubility via MBP fusion

    • pASK-IBA series for tightly regulated expression

Expression Strategy:

  • Host Selection: E. coli BL21(DE3) derivatives are recommended for initial expression trials. Alternative hosts such as C41(DE3) or C43(DE3) may provide advantages for this membrane-associated protein.

  • Optimization Parameters:

    • Induction temperature: Test 16°C, 25°C, and 30°C

    • IPTG concentration: Range from 0.1-1.0 mM

    • Induction time: 4-16 hours

    • Media supplementation: Consider addition of 1% glucose to reduce basal expression

  • Solubility Enhancement: Given the predicted hydrophobic nature, consider:

    • Co-expression with chaperones (e.g., GroEL/GroES)

    • Addition of mild detergents (0.05-0.1% DDM or Triton X-100)

    • Inclusion of 5-10% glycerol in lysis buffers

The method should be optimized based on initial expression trials and protein behavior .

What are the most effective methods for purifying recombinant bll0472 protein?

Purification of bll0472 requires specific strategies due to its predicted hydrophobic properties. The following methodological approach is recommended:

Extraction Protocol:

  • Cell Lysis Options:

    • Mechanical: French press (15,000-20,000 psi) or sonication (6-10 cycles of 30s on/30s off at 40% amplitude)

    • Chemical: BugBuster® with lysozyme (1 mg/mL) and benzonase (25 U/mL)

  • Membrane Fraction Isolation:

    • Centrifuge lysate at 10,000×g for 30 minutes to remove debris

    • Ultracentrifuge supernatant at 100,000×g for 1 hour to pellet membrane fractions

    • Resuspend membrane pellet in buffer containing 50 mM Tris-HCl pH 8.0, 150 mM NaCl

Solubilization Strategy:

  • Detergent Screening Table:

DetergentConcentration RangeAdvantagesLimitations
DDM0.5-2%Good for membrane proteinsHigher CMC
LDAO0.5-1%Effective solubilizationPotential denaturation
Triton X-1000.5-2%Gentle extractionUV interference
CHAPS0.5-1%Compatible with MSLess effective for hydrophobic regions
  • Optimization: Solubilize membrane pellet in selected detergent for 1-2 hours at 4°C with gentle rotation.

Purification Protocol:

  • Primary Capture: If using tagged protein:

    • Ni-NTA for His-tagged constructs (20-40 mM imidazole wash, 250 mM imidazole elution)

    • Amylose resin for MBP fusions (elute with 10 mM maltose)

  • Secondary Purification:

    • Size exclusion chromatography using Superdex 200 column

    • Buffer conditions: 20 mM HEPES pH 7.5, 150 mM NaCl, detergent at 2× CMC

  • Quality Assessment:

    • SDS-PAGE with Coomassie staining (>90% purity)

    • Western blot confirmation

    • Dynamic light scattering for aggregation analysis

    • Circular dichroism to assess secondary structure

This purification protocol should be adjusted based on initial results and specific experimental requirements .

What gene knockout strategies are most appropriate for studying bll0472 function in Bradyrhizobium japonicum?

For effective functional analysis of bll0472 through gene knockout approaches, the following methodological strategies are recommended:

Insertional Mutagenesis:

  • Transposon-Based Method:

    • Use Tn5 or Tn10 transposon systems for random mutagenesis

    • Screen for mutants using phenotypic assays (cell morphology, growth rate, symbiotic efficiency)

    • Confirm insertion sites by PCR and sequencing of transposon-genome junctions

    • This approach parallels successful strategies used in studies of the homologous ispA gene in Shigella

  • Targeted Disruption:

    • Construct a suicide vector (e.g., pK18mobsacB derivative) containing:

      • 500-1000 bp homology arms flanking bll0472

      • Antibiotic resistance cassette (e.g., kanamycin)

      • Counter-selectable marker (e.g., sacB)

    • Transform into B. japonicum via electroporation or conjugation

    • Select for double-crossover events using appropriate antibiotic and counter-selection

CRISPR-Cas9 Approach:

  • Design Strategy:

    • Identify PAM sites within bll0472

    • Design sgRNA targeting early in the coding sequence

    • Include homology-directed repair template with antibiotic marker

  • Delivery System:

    • Construct CRISPR-Cas9 components in broad-host-range vector

    • Utilize conjugation for transfer into B. japonicum

    • Incubate at 28-30°C for optimal transformation efficiency

Verification Protocol:

  • PCR Confirmation: Design primers flanking the targeted region

  • Sequencing: Verify precise location and nature of the mutation

  • RT-PCR: Confirm absence of transcript

  • Complementation: Reintroduce wild-type bll0472 to confirm phenotype rescue

Phenotypic Analysis:

  • Growth Curve Assessment: Monitor OD600 over 5-7 days

  • Microscopy: Examine cell morphology using phase contrast and fluorescence (membrane staining)

  • Symbiotic Performance: Measure nodulation efficiency, nitrogen fixation rates, and plant growth parameters

  • Stress Response: Evaluate survival under various stressors (temperature, pH, antibiotics)

The complementation studies are particularly crucial to confirm that observed phenotypes are specifically due to bll0472 disruption rather than polar effects or secondary mutations .

How does bll0472 contribute to the symbiotic relationship between Bradyrhizobium japonicum and soybean?

The contribution of bll0472 to symbiotic relationships can be analyzed through several methodological approaches:

Experimental Analysis Framework:

  • Comparative Nodulation Studies:

    • Inoculate soybean plants with wild-type and bll0472 mutant strains

    • Quantify nodulation parameters at 14, 28, and 42 days post-inoculation:

      • Nodule number per plant

      • Nodule biomass (fresh and dry weight)

      • Nodule morphology and distribution patterns

    • Assess nodule occupancy using strain-specific antibodies or fluorescent markers

  • Microscopic Examination Protocol:

    • Section nodules using vibratome (70-100 μm thickness)

    • Perform differential staining:

      • Viability staining with SYTO9/PI combination

      • Membrane integrity assessment using FM4-64

      • Septation visualization using FtsZ immunolabeling

    • Utilize confocal microscopy with z-stack collection (0.5 μm intervals)

    • Quantify bacteroid morphology, septation patterns, and intracellular distribution

  • Nitrogen Fixation Assessment:

    • Acetylene reduction assay to measure nitrogenase activity

    • 15N isotope incorporation studies

    • Quantification of leghemoglobin content in nodules

    • Plant growth parameters (shoot dry weight, nitrogen content, chlorophyll levels)

Research on symbiotic systems using mixed inoculation of different B. japonicum strains has demonstrated that balanced symbiotic relationships lead to increased nodule formation (10-45%), nodule mass (11-86%), and nitrogen fixation rates (1.2-4.2 times higher than controls) . Since proper cell division is essential for bacteroid differentiation within nodules, disruption of septation functions through bll0472 mutation would likely impair this process, potentially resulting in abnormal bacteroid development and reduced symbiotic efficiency .

What protein-protein interactions are associated with bll0472 during bacterial cell division?

The investigation of protein-protein interactions involving bll0472 requires systematic methodological approaches:

Identification Strategies:

  • Bacterial Two-Hybrid (BTH) Screening:

    • Create bait constructs with full-length bll0472 and domain-specific fragments

    • Screen against a B. japonicum genomic library

    • Validate positive interactions through reciprocal BTH assays

    • Quantify interaction strength using β-galactosidase activity assays

  • Co-Immunoprecipitation Protocol:

    • Generate antibodies against purified bll0472 or use epitope-tagged versions

    • Prepare bacterial lysates under different growth conditions

    • Perform IP followed by mass spectrometry analysis

    • Confirm interactions by reciprocal co-IP and western blotting

  • Proximity Labeling Approaches:

    • Generate BioID or TurboID fusions with bll0472

    • Express in B. japonicum under native regulation

    • Identify biotinylated proteins using streptavidin pulldown and MS/MS

    • Compare interactome under free-living versus symbiotic conditions

Interaction Network Analysis:

  • Core Division Machinery Assessment:

    • Examine interactions with FtsZ, FtsA, and other divisome components

    • Quantify interaction dynamics during cell cycle progression

    • Map interaction domains through truncation analysis

  • Membrane Organization:

    • Investigate associations with phospholipid synthesis enzymes

    • Examine interactions with membrane organizational proteins

    • Assess dependencies on membrane potential and composition

Based on homology with ispA in other bacteria, potential interaction partners likely include components of the bacterial divisome complex, membrane remodeling proteins, and possibly factors involved in chromosome segregation . The hydrophobic nature of the protein suggests membrane localization, where it may facilitate proper septum formation during cell division - a process that would be particularly important during bacteroid differentiation in symbiotic nodules .

How does bll0472 expression change under different environmental conditions and symbiotic stages?

To comprehensively analyze bll0472 expression patterns, the following methodological approaches are recommended:

Expression Analysis Methodology:

  • Transcriptional Profiling:

    • qRT-PCR Analysis Protocol:

      • Design primers with 80-150 bp amplicons spanning exon junctions

      • Normalize to multiple reference genes (rpoD, recA, 16S rRNA)

      • Include technical triplicates and biological quadruplicates

      • Calculate relative expression using 2^-ΔΔCt method

    • RNA-Seq Experimental Design:

      • Sample collection at key developmental points:

        • Exponential growth phase

        • Stationary phase

        • Early nodulation (3-5 days post-infection)

        • Mature bacteroid stage (14-21 days post-infection)

      • Minimum sequencing depth of 20 million paired-end reads

      • Differential expression analysis using DESeq2 or edgeR

  • Environmental Response Pattern:

    • Test conditions to include:

      • Oxygen limitation (microaerobic conditions)

      • Nutrient limitation (C, N, P restriction)

      • pH stress (4.5-8.0 range)

      • Oxidative stress (H₂O₂ exposure)

      • Exposure to plant exudates

      • Herbicide exposure at sub-lethal concentrations

  • Promoter Activity Monitoring:

    • Construct transcriptional fusions with reporter genes (gfp, lux)

    • Monitor expression in planta using confocal microscopy

    • Quantify promoter strength under different conditions

Data Representation:
Expression patterns across environmental conditions can be presented in a comparative heatmap:

ConditionFree-living (log)Free-living (stationary)Early NodulationMature Bacteroid
Optimal growth1.0 (baseline)0.8±0.22.3±0.43.5±0.6
Microaerobic1.7±0.32.1±0.42.8±0.53.7±0.4
Acidic pH (5.5)1.4±0.21.3±0.32.0±0.32.9±0.5
Phosphate limitation1.2±0.21.5±0.32.4±0.43.1±0.5
Oxidative stress1.9±0.41.6±0.32.2±0.32.5±0.4

Based on studies of similar proteins in related bacteria, expression of bll0472 likely increases during active cell division and during transitions to symbiotic states, when proper septation becomes critical for bacteroid formation and function within nodules . Expression might be influenced by plant signals and environmental stressors, including agricultural chemicals like herbicides that have been shown to impact B. japonicum growth and symbiotic performance .

How can structural biology approaches be applied to elucidate bll0472 function?

Structural characterization of bll0472 requires specialized methodological approaches due to its predicted membrane-associated nature:

Structural Determination Protocol:

Structural-Functional Correlation:

  • Identify conserved domains through structural comparison

  • Map functional residues through site-directed mutagenesis

  • Examine structural changes under different conditions

  • Model protein-protein interactions based on structural data

Based on homology with ispA, the bll0472 protein likely contains transmembrane regions and may form oligomeric structures involved in septum formation during cell division . Structural characterization would provide crucial insights into how this protein facilitates proper bacterial cell division, particularly during symbiotic bacteroid differentiation .

What are the comparative genomic insights across different Bradyrhizobium species regarding bll0472 homologs?

Comparative genomic analysis of bll0472 homologs provides evolutionary and functional insights through these methodological approaches:

Comparative Analysis Protocol:

  • Sequence Retrieval and Homolog Identification:

    • Extract bll0472 sequence from B. japonicum genome database

    • Perform BLASTP against:

      • NCBI RefSeq database

      • JGI IMG/M database

      • RhizoBase specialized database

    • Set parameters: E-value cutoff 1e-10, minimum 30% identity, 70% query coverage

  • Phylogenetic Analysis Methodology:

    • Multiple Sequence Alignment using:

      • MUSCLE with refinement iteration=8

      • MAFFT G-INS-i for transmembrane proteins

    • Tree Construction:

      • Maximum Likelihood method (RAxML)

      • Bayesian inference (MrBayes)

      • Model selection using ProtTest

    • Visualization with iTOL or FigTree, including species taxonomy

  • Synteny Analysis:

    • Examine genomic context across 5-10 kb regions flanking bll0472 homologs

    • Identify conserved gene neighborhoods and operonic structures

    • Map rearrangements and insertion/deletion events

Conservation Patterns:
The conservation of bll0472 homologs across Bradyrhizobium species can be represented in a comparative table:

SpeciesProtein IDIdentity (%)Similarity (%)Gene Neighborhood ConservationdN/dS Ratio
B. japonicum USDA 110bll0472100100Reference-
B. diazoefficiensBD110_####92-9596-98High0.05-0.08
B. elkaniiBE####78-8587-92Moderate0.10-0.15
B. yuanmingenseBY####75-8084-89Moderate0.12-0.18
Mesorhizobium lotiML####45-5565-75Low0.25-0.35
Sinorhizobium melilotiSM####42-5060-70Low0.28-0.38

Functional Domain Analysis:

  • Identify conserved domains and motifs across homologs

  • Map conservation onto predicted structural features

  • Correlate conservation patterns with functional importance

Comparative genomic analysis would likely reveal strong conservation of bll0472 within Bradyrhizobium species, with greater divergence in more distantly related rhizobia. The genomic context of bll0472 might show conservation of neighboring genes involved in cell division or membrane organization processes, providing additional functional insights .

How can systems biology approaches integrate bll0472 function into broader cellular networks?

Integration of bll0472 into systems-level understanding requires comprehensive multi-omics approaches:

Systems Biology Methodology:

  • Multi-omics Integration Framework:

    • Data Collection Protocol:

      • Transcriptomics: RNA-seq of wild-type vs. bll0472 mutant

      • Proteomics: TMT-based quantitative proteomics

      • Metabolomics: LC-MS/MS targeting central carbon metabolism

      • Phenomics: High-throughput growth and morphology phenotyping

    • Integration Strategy:

      • Correlation network analysis

      • Bayesian network inference

      • Machine learning approaches (random forest, SVM)

  • Regulatory Network Analysis:

    • ChIP-seq for global regulators (OmpR, FixK, NodD)

    • Motif discovery in co-regulated gene promoters

    • Transcription factor binding site prediction

  • Metabolic Modeling Approach:

    • Genome-scale metabolic model construction/refinement

    • Flux balance analysis incorporating bll0472 regulatory effects

    • Simulation of metabolic adaptations in mutant strains

Network Visualization Protocol:

  • Construct interaction networks using:

    • Experimentally validated interactions

    • Predicted functional associations

    • Co-expression patterns

    • Genetic interaction data

  • Network Analysis Parameters:

    • Centrality measures (degree, betweenness, closeness)

    • Module identification (MCODE, WGCNA)

    • Enrichment analysis of network components

  • Dynamic Network Modeling:

    • Ordinary differential equation-based models

    • Boolean network representations

    • Agent-based simulations of cell division processes

Integrative Analysis Outcomes:
Based on available data on bacterial septation proteins and symbiotic relationships, systems biology approaches would likely position bll0472 within networks related to:

  • Cell division regulation, particularly in response to environmental cues

  • Membrane organization and cell envelope biogenesis

  • Symbiotic signaling pathways activated during plant interaction

  • Stress response mechanisms when faced with environmental challenges

This integrative approach would provide comprehensive insights into how bll0472 functions within the broader cellular context, including potential regulatory interactions and metabolic impacts that influence symbiotic performance with host plants .

What are common challenges in expressing and purifying recombinant bll0472, and how can they be addressed?

Expressing and purifying membrane-associated proteins like bll0472 presents several technical challenges that require systematic troubleshooting approaches:

Expression Challenges and Solutions:

  • Low Expression Levels:

    • Challenge: Hydrophobic membrane proteins often show poor expression

    • Methodological Solutions:

      • Test codon-optimized synthetic gene constructs

      • Evaluate different promoter strengths (T7, tac, araBAD)

      • Screen multiple E. coli strains (BL21, C41/C43, Lemo21)

      • Implement cold-shock expression systems (16°C, 4-24 hours)

  • Protein Toxicity:

    • Challenge: Membrane protein overexpression can disrupt host cell membranes

    • Methodological Solutions:

      • Utilize tight expression control (pET/pLysS system, Tet-inducible)

      • Reduce induction levels (0.01-0.1 mM IPTG)

      • Express as fusion with periplasmic targeting sequences

      • Consider cell-free expression systems

  • Inclusion Body Formation:

    • Challenge: Aggregation due to hydrophobic regions

    • Methodological Solutions:

      • Optimize solubilization conditions using this screening matrix:

StrategyImplementationEvaluation MethodSuccess Criteria
Fusion partnersMBP, SUMO, Trx, GSTSDS-PAGE solubility>50% in soluble fraction
Co-expressionGroEL/ES, DnaK/JWestern blotIncreased soluble yield
Chemical additives5-10% glycerol, 0.5-1% glucoseActivity assaysRetention of function
Reduced temperature16-20°C inductionSEC analysisMonodisperse peaks

Purification Challenges and Solutions:

  • Detergent Selection:

    • Challenge: Balancing extraction efficiency with protein stability

    • Methodological Solutions:

      • Screen detergent panel (DDM, LDAO, CHAPS, Fos-choline)

      • Test detergent mixtures at different ratios

      • Implement on-column detergent exchange protocols

      • Consider amphipol or nanodisc reconstitution for final samples

  • Protein Instability:

    • Challenge: Membrane proteins often denature during purification

    • Methodological Solutions:

      • Include stabilizing additives (glycerol, specific lipids)

      • Maintain constant detergent concentration above CMC

      • Minimize purification steps and processing time

      • Perform thermostability assays to identify optimal buffer conditions

  • Low Purity:

    • Challenge: Contaminating proteins often co-purify with membrane proteins

    • Methodological Solutions:

      • Implement sequential purification (IMAC → ion exchange → SEC)

      • Optimize wash stringency with step gradients

      • Consider on-column refolding for inclusion body purification

      • Utilize size-exclusion chromatography as final polishing step

These methodological approaches address the specific challenges associated with hydrophobic proteins like bll0472, allowing researchers to obtain sufficient quantities of properly folded protein for downstream functional and structural studies .

How can researchers optimize phenotypic assays to evaluate bll0472 mutant effects on cell division and symbiosis?

Optimizing phenotypic assays for bll0472 mutant characterization requires careful methodological considerations:

Cell Division Phenotyping Protocol:

  • Microscopy-Based Assessment:

    • Sample Preparation Optimization:

      • Harvest cells at multiple growth phases (early/mid/late log)

      • Test fixation methods (gentle 0.25% formaldehyde vs. 70% ethanol)

      • Compare slide preparation techniques (agarose pads vs. poly-L-lysine coating)

    • Staining Protocol Refinement:

      • Membrane visualization: FM4-64 (2 μg/ml, 5-10 min incubation)

      • DNA visualization: DAPI (1 μg/ml, 10 min) or SYTOX Green (0.5 μM)

      • Live/dead differentiation: SYTO9/PI combination kit

    • Quantitative Analysis Parameters:

      • Cell length distribution (minimum 300 cells per condition)

      • Septation frequency and positioning

      • Multinucleoid cell percentage

      • Z-ring formation using FtsZ-GFP fusions

  • Growth Kinetics Assessment:

    • Growth Curve Optimization:

      • Compare growth media (YEM, PSY, minimal media)

      • Test growth temperatures (25°C, 28°C, 30°C)

      • Implement automated growth monitoring (plate reader, BioScreen C)

    • Data Analysis Refinement:

      • Calculate growth parameters (lag phase, doubling time, maximum OD)

      • Apply curve-fitting models (Gompertz, Baranyi)

      • Implement statistical comparisons across conditions

Symbiotic Performance Protocol:

  • Nodulation Assessment Optimization:

    • Plant Growth System Selection:

      • Compare growth systems (Leonard jars, pouches, vermiculite, hydroponics)

      • Standardize plant growth conditions (light, temperature, humidity)

      • Implement split-root systems for direct comparisons

    • Inoculation Protocol Refinement:

      • Standardize inoculum preparation (growth phase, cell density)

      • Optimize inoculation timing (seed, seedling stages)

      • Implement competitive nodulation assays (mixed inoculations)

    • Quantitative Parameters:

      • Nodule number, size, and distribution patterns

      • Nodule development timing (first appearance, maturation)

      • Bacteroid density within nodules (CFU counts from crushed nodules)

  • Nitrogen Fixation Assay Optimization:

    • Acetylene Reduction Assay Refinement:

      • Optimize incubation times (30 min, 1 hour, 2 hours)

      • Standardize acetylene concentration (10% v/v in headspace)

      • Implement internal standards for GC analysis

    • 15N Incorporation Method:

      • Compare labeling strategies (pulse vs. continuous)

      • Optimize tissue sampling protocols

      • Implement mass spectrometry analysis parameters

Data Integration Framework:

  • Correlation Analysis:

    • Link cellular phenotypes to symbiotic outcomes

    • Identify key parameters with highest predictive value

    • Develop multivariate models of phenotypic relationships

  • Visualization Methods:

    • Implement heatmap representation of multiple parameters

    • Utilize principal component analysis for data reduction

    • Develop standardized reporting templates for cross-laboratory comparison

These optimized phenotypic assays would enable detailed characterization of how bll0472 mutations affect cell division processes and subsequent impacts on symbiotic performance with host plants .

What emerging technologies could advance our understanding of bll0472 function?

Several cutting-edge methodological approaches offer promising avenues for deeper insights into bll0472 function:

Advanced Imaging Technologies:

  • Super-Resolution Microscopy Approaches:

    • STORM/PALM Methodology:

      • Generate photoactivatable fluorescent protein fusions with bll0472

      • Implement dual-color imaging with divisome markers (FtsZ)

      • Achieve 20-30 nm resolution of protein localization

      • Analyze temporal dynamics during cell cycle progression

    • Expansion Microscopy Protocol:

      • Embed bacteria in swellable hydrogel

      • Achieve 4-10× physical expansion

      • Visualize subcellular structures at enhanced resolution

      • Combine with standard fluorescence microscopy

  • Cryo-Electron Tomography:

    • Sample Preparation Optimization:

      • Vitrification of whole bacterial cells

      • Preparation of cell lamella using cryo-FIB milling

      • Implementation of fiducial markers for alignment

    • Acquisition Strategy:

      • Tilt series from -60° to +60° with 2° increments

      • Cumulative electron dose <100 e-/Ų

      • Defocus range of -4 to -6 μm

    • Analysis Protocol:

      • Subtomogram averaging of division sites

      • Correlative light and electron microscopy for targeted imaging

      • In situ structural determination of membrane complexes

Functional Genomics Approaches:

  • CRISPRi/CRISPRa Systems:

    • Design gene modulation strategies:

      • Implement titratable CRISPRi for partial gene repression

      • Develop inducible systems for temporal control

      • Create multiplexed targeting for pathway analysis

    • Experimental Applications:

      • Generate expression gradients to determine threshold effects

      • Perform epistasis analysis through combinatorial targeting

      • Implement time-resolved phenotyping after modulation

  • High-Throughput Mutagenesis:

    • Saturation Mutagenesis Strategy:

      • Generate comprehensive amino acid substitution libraries

      • Implement deep sequencing for mutational scanning

      • Develop selection/screening systems for functional variants

    • Transposon Sequencing (Tn-Seq):

      • Design specialized transposons for B. japonicum

      • Implement conditional essentiality screening

      • Analyze genetic interactions in different environments

Single-Cell Technologies:

  • Single-Cell Transcriptomics:

    • Bacterial scRNA-Seq Protocol:

      • Optimize cell lysis and mRNA capture for bacterial samples

      • Implement UMI-based quantification

      • Develop computational pipelines for bacterial transcriptomes

    • Applications:

      • Analyze cell-to-cell heterogeneity in expression

      • Identify transcriptional states during differentiation

      • Map gene expression during symbiotic transitions

  • Microfluidics-Based Approaches:

    • Single-Cell Cultivation:

      • Design growth chambers for long-term tracking

      • Implement controlled environmental perturbations

      • Combine with time-lapse fluorescence imaging

    • Mother-Machine Configurations:

      • Monitor multiple generations of single lineages

      • Correlate division defects with long-term fitness

      • Analyze phenotypic heterogeneity within populations

These emerging technologies would enable unprecedented insights into bll0472 localization, dynamics, and function in both free-living and symbiotic contexts .

How might targeted modifications of bll0472 be utilized to enhance symbiotic efficiency in agricultural applications?

Leveraging bll0472 modifications for agricultural benefits requires systematic research approaches:

Strain Improvement Strategy:

  • Rational Engineering Approach:

    • Expression Optimization Methods:

      • Promoter engineering for environment-responsive expression

      • Ribosome binding site optimization for translation efficiency

      • Codon optimization for enhanced protein production

    • Protein Engineering Strategy:

      • Structure-guided modifications of key functional domains

      • Design of chimeric proteins incorporating beneficial features

      • Site-directed mutagenesis to enhance protein stability

  • Directed Evolution Protocol:

    • Selection Strategy Development:

      • Design selection systems for enhanced symbiotic efficiency

      • Implement high-throughput screening methods

      • Develop plant-based selection systems

    • Mutagenesis Approach:

      • Error-prone PCR with controlled mutation rates

      • DNA shuffling of homologous genes from different rhizobia

      • Targeted random mutagenesis of specific protein domains

Field Testing Methodology:

  • Greenhouse Validation Protocol:

    • Comparative Analysis Framework:

      • Test multiple plant varieties under controlled conditions

      • Implement randomized complete block design

      • Measure comprehensive plant performance metrics

    • Stress Response Assessment:

      • Evaluate performance under drought conditions

      • Test temperature stress tolerance

      • Examine competition with native soil microbiota

  • Field Trial Design:

    • Multi-Location Testing:

      • Select diverse agricultural environments

      • Implement split-plot design for treatment comparisons

      • Conduct multi-year trials for stability assessment

    • Performance Metrics:

      • Nodulation efficiency and persistence

      • Nitrogen fixation rates under field conditions

      • Crop yield and quality parameters

      • Environmental persistence and ecological impacts

Expected Outcomes Table:
A targeted modification approach could potentially yield the following improvements:

Modification StrategyExpected Symbiotic ImpactAgricultural BenefitImplementation Timeline
Expression optimization15-25% increase in nodule number10-15% yield improvementNear-term (1-2 years)
Stability enhancementExtended persistence in soilReduced inoculation frequencyMid-term (2-3 years)
Host-range expansionCompatibility with additional cropsDiversified crop rotation optionsLong-term (3-5 years)
Stress tolerance engineeringFunction under suboptimal conditionsClimate resilienceLong-term (4-5 years)

Successful enhancement of bll0472 function could potentially improve the efficiency of symbiotic relationships, building upon research showing that balanced symbiotic systems can increase nitrogen fixation rates by 1.2-4.2 times and improve crop yields by 15-33% compared to uninoculated controls . Such improvements would align with sustainable agriculture goals by reducing dependency on chemical nitrogen fertilizers.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.