Recombinant Bradyrhizobium japonicum Probable Ni/Fe-hydrogenase B-type cytochrome subunit (hupC)

Shipped with Ice Packs
In Stock

Description

Functional Role in Hydrogenase Activity

hupC serves as the cytochrome b subunit of the Ni/Fe-hydrogenase complex, facilitating electron transfer during H₂ oxidation. Key functional insights include:

  • Electron Transport: Acts as a redox partner, transferring electrons from the catalytic heterodimer (HupSL) to the quinone pool .

  • Heme Coordination: Contains conserved histidine residues (e.g., His33, His74) critical for binding two heme groups, as shown in homologous systems .

  • Oxygen Sensitivity: Hydrogenase activity in wild-type B. japonicum is repressed under atmospheric O₂, but Hupc mutants exhibit constitutive expression, suggesting altered regulatory mechanisms .

Genetic and Regulatory Insights

  • Operon Structure: hupC is part of the hupSLCDF operon, with upstream regulatory genes hupU and hupV encoding nickel-sensing proteins essential for hydrogenase transcription .

  • Nickel Dependence: Hydrogenase expression requires nickel, which regulates transcription via HupUV. HupV contains nickel-binding motifs (RxCGxC and DPCxxCxxH) homologous to the large hydrogenase subunit .

Mutant Phenotypes

Mutation TypeObserved EffectSource
hupV deletionComplete loss of hydrogenase activity
Hupc mutants (e.g., SR470)Constitutive hydrogenase synthesis under high O₂
Nickel uptake mutants10-fold higher nickel accumulation in Hupc strains

Applications in Research

  • Enzyme Purification: The His-tagged recombinant protein enables efficient isolation for structural studies .

  • Metabolic Engineering: Used to investigate H₂ production efficiency in symbiotic nitrogen fixation .

  • Nickel Sensing Studies: Serves as a model for tracing nickel’s role in metalloenzyme regulation .

Technical Advancements

A novel antibiotic resistance-based selection method (using kanamycin/spectinomycin cassettes) has streamlined the generation of B. japonicum mutants, aiding hupC functional studies .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we currently have in stock. However, if you have specific requirements for the format, please indicate them in your order. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery times.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life for the liquid form is 6 months at -20°C/-80°C. The shelf life for the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type in mind, please inform us and we will prioritize development of the specified tag.
Synonyms
hupC; bll6940; Probable Ni/Fe-hydrogenase B-type cytochrome subunit
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-247
Protein Length
full length protein
Species
Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110)
Target Names
hupC
Target Protein Sequence
MMDAVAPASDAGPDLAAIAADASGERAVGRPTVYVYEAPVRICHWVNAFSIIVLMVTGYL IGTPLPTVAGEASDNFVMGYIRFAHFAAGQVLAVFFLTRILWAFVGNHHSRQIFYIPVHR KQFWKEVLHEIRWYAFLEREPKMYVGHNPLAQTAMFTGFTLFVAFMIVTGFALYSEGQGI DSWQHKLFGWVFAIWPNSQDVHTWHHLGMWALVVFVMVHIYAAVREDIMSRQSIISSMIS GERQFRD
Uniprot No.

Target Background

Function
B-type cytochrome involved in electron transfer from hydrogenase to oxygen.
Database Links

KEGG: bja:bll6940

STRING: 224911.bll6940

Protein Families
HupC/HyaC/HydC family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What growth conditions are optimal for studying hydrogenase expression in Bradyrhizobium japonicum?

For studying hydrogenase expression in B. japonicum, researchers should consider:

  • Autotrophic conditions: Microaerobic environment with 1% oxygen, 10% hydrogen, and 5% carbon dioxide in minimal medium lacking organic carbon sources

  • Heterotrophic conditions: Standard growth medium with organic carbon sources, typically used as a control

  • Semi-aerobic induction: An atmosphere containing 2% oxygen and 2% hydrogen, which induces uptake hydrogenase expression without activating RuBisCO activity

For experimental measurements of hydrogenase activity, cultures should be grown to mid-logarithmic phase (OD600 of approximately 0.5-0.7) for consistent results .

How does the regulatory mechanism of hydrogenase expression work in wild-type versus Hupc mutant strains?

In wild-type B. japonicum, hydrogenase expression is regulated by environmental factors:

  • Nickel concentration: Required as a cofactor for hydrogenase activity

  • Oxygen levels: Expression is highest under microaerobic conditions

  • Hydrogen presence: Acts as an inducer for hydrogenase expression

In contrast, Hupc mutant strains (such as SR470, SR473, and JH101) express hydrogenase constitutively regardless of nickel, oxygen, or hydrogen levels. The critical regulatory region has been identified between -149 and -98 bases upstream of the hydrogenase structural gene . This region is the site for nickel, oxygen, and hydrogen-dependent regulation in wild-type strains. Current evidence suggests that Hupc strains harbor a mutation affecting a trans-acting factor that would normally respond to Ni, O2, and H2 environmental signals .

What experimental design would be optimal for investigating the specific binding sites of trans-acting factors in the hupC regulatory region?

To investigate specific binding sites of trans-acting factors in the hupC regulatory region, a multi-faceted experimental approach is recommended:

  • DNA Footprinting Analysis:

    • Create a series of labeled DNA fragments containing the -149 to -98 regulatory region

    • Incubate with cell extracts from wild-type and Hupc mutant strains

    • Compare protected regions to identify potential binding sites

  • Site-directed Mutagenesis:

    • Generate a series of point mutations across the -149 to -98 region

    • Test each mutant for response to Ni, O2, and H2 using reporter gene assays

    • Create the following mutation matrix:

PositionWild-type sequenceMutant variantsResponse to NiResponse to O2Response to H2
-149 to -140Original sequenceVariant 1, 2, 3DataDataData
-139 to -130Original sequenceVariant 1, 2, 3DataDataData
-129 to -120Original sequenceVariant 1, 2, 3DataDataData
-119 to -110Original sequenceVariant 1, 2, 3DataDataData
-109 to -98Original sequenceVariant 1, 2, 3DataDataData
  • Electrophoretic Mobility Shift Assays (EMSA):

    • Use purified regulatory proteins or cell extracts

    • Test binding under various Ni, O2, and H2 concentrations

    • Include competition assays with unlabeled DNA fragments

  • ChIP-seq Analysis:

    • Perform chromatin immunoprecipitation followed by sequencing

    • Compare binding profiles between wild-type and Hupc mutant strains

    • Correlate with transcriptional activity data

This comprehensive approach would provide multiple lines of evidence regarding the specific binding sites and their interactions with regulatory factors.

How can transcriptomic data be integrated with biochemical analyses to elucidate the complete hydrogenase regulatory network in Bradyrhizobium japonicum?

Integration of transcriptomic data with biochemical analyses requires a systematic approach:

  • Transcriptomic Analysis:

    • Perform whole-genome microarray or RNA-seq experiments comparing:

      • Chemoautotrophic vs. heterotrophic growth

      • Various oxygen, hydrogen, and nickel concentrations

      • Wild-type vs. Hupc mutant strains

    • Identify differentially expressed genes using statistical methods (p < 0.05, fold change > 2)

  • Protein-Protein Interaction Studies:

    • Use pull-down assays with tagged hupC protein

    • Perform yeast two-hybrid or bacterial two-hybrid screens

    • Validate interactions with co-immunoprecipitation

  • Integration Framework:

    • Create a regulatory network model incorporating:

      • Transcription factors identified from genetic screens

      • Metabolic intermediates affecting regulation

      • Environmental sensors for O2, H2, and Ni

  • Validation Studies:

    • Generate knockout mutants of key regulatory elements

    • Perform complementation studies

    • Assess phenotypic consequences using growth curves, hydrogenase activity assays, and transcriptional profiling

One study using microarray analysis identified 1,485 transcripts (17.5% of the genome) as differentially expressed when comparing chemoautotrophic to heterotrophic cultures, with genes required for hydrogen utilization and carbon fixation being strongly induced in chemoautotrophically cultured cells .

What methods can be used to resolve contradictory data regarding hupC regulation in different experimental systems?

When faced with contradictory data regarding hupC regulation, consider these methodological approaches:

  • Standardize Experimental Conditions:

    • Create a unified protocol for culture conditions

    • Standardize bacterial growth phases for experiments

    • Use identical media compositions across laboratories

  • Multi-variable Analysis:

    • Design factorial experiments examining interactions between:

      • Oxygen concentration (0%, 1%, 2%, 5%, 10%)

      • Hydrogen availability (0%, 2%, 5%, 10%)

      • Nickel concentration (0 μM, 0.1 μM, 0.5 μM, 1.0 μM)

      • Carbon source availability

    • Analyze data using ANOVA to identify significant interactions

  • Strain Verification:

    • Sequence verify all strains to confirm genetic identity

    • Use standardized reference strains (USDA110, USDA122)

    • Document strain passage history to identify potential genetic drift

  • Technical Validation:

    • Use multiple measurement techniques for key phenotypes

    • Perform inter-laboratory validation studies

    • Blind sample analysis to eliminate researcher bias

  • Meta-analysis Approach:

    • Systematically compare published results

    • Weight evidence based on methodological rigor

    • Identify patterns across contradictory findings

For instance, one study showed that β-galactosidase activity from hup-lacZ fusions in Hupc strains remained constant across various concentrations of Ni (0 μM to 1 μM), O2 (0%-10%), and H2 (0%-10%), while wild-type strains showed variable expression levels under the same conditions .

What are the recommended protocols for purifying recombinant hupC protein for structural studies?

For high-purity recombinant hupC protein isolation suitable for structural studies:

  • Expression System Optimization:

    • Use E. coli BL21(DE3) with the pET vector system

    • Include an N-terminal His-tag for purification

    • Express at 18°C overnight after induction with 0.1-0.5 mM IPTG

  • Cell Lysis Protocol:

    • Harvest cells by centrifugation (6,000 × g, 10 min, 4°C)

    • Resuspend in lysis buffer: 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10 mM imidazole, 1 mM DTT, protease inhibitor cocktail

    • Lyse cells by sonication or French press

    • Clarify lysate by centrifugation (15,000 × g, 30 min, 4°C)

  • Purification Strategy:

    • Primary purification: Ni-NTA affinity chromatography

      • Load clarified lysate onto equilibrated Ni-NTA column

      • Wash with 20 column volumes of wash buffer (lysis buffer with 20 mM imidazole)

      • Elute with elution buffer (lysis buffer with 250 mM imidazole)

    • Secondary purification: Size exclusion chromatography

      • Use Superdex 200 column equilibrated with 20 mM Tris-HCl pH 7.5, 150 mM NaCl, 5% glycerol

      • Collect fractions and analyze by SDS-PAGE

  • Protein Concentration and Storage:

    • Concentrate to 1-5 mg/ml using centrifugal concentrators

    • Store in buffer containing 20 mM Tris-HCl pH 8.0, 150 mM NaCl, 6% trehalose

    • Flash-freeze in liquid nitrogen and store at -80°C

    • Avoid repeated freeze-thaw cycles

The purified protein should achieve >90% purity as determined by SDS-PAGE for structural studies .

How can researchers design experiments to study the effects of oxygen concentration on hupC expression and activity?

To study oxygen effects on hupC expression and activity:

  • Controlled Atmosphere Cultivation System:

    • Use bioreactors with precise O2 control (0.1-10% range)

    • Maintain constant temperature, pH, and mixing conditions

    • Include dissolved oxygen probes for real-time monitoring

  • Experimental Design Considerations:

    • Implement a randomized block design with three replicates per oxygen level

    • Include appropriate controls (positive, negative, vehicle)

    • Use factorial design to test interaction with other variables (H2, Ni)

  • Expression Analysis Methods:

    • Transcriptional level: qRT-PCR targeting hupC mRNA

    • Translational level: Western blot with anti-hupC antibodies

    • Reporter systems: hupC promoter fused to fluorescent proteins or β-galactosidase

  • Activity Assays:

    • In vitro hydrogen uptake: Measure H2 consumption using gas chromatography

    • Electron transport: Spectrophotometric assays with artificial electron acceptors

    • Whole-cell assays: Amperometric measurement of H2 oxidation

  • Data Collection and Analysis:

    • Collect time-course data over 24-72 hours

    • Use mixed-effects ANOVA to analyze results

    • Apply non-linear regression for enzyme kinetics parameters

Oxygen Level (%)Relative hupC ExpressionHydrogenase Activity (nmol H₂/min/mg protein)Growth Rate (μ)
0DataDataData
0.5DataDataData
1.0DataDataData
2.0DataDataData
5.0DataDataData
10.0DataDataData
21.0DataDataData

Based on previous studies, maximum hydrogenase expression is typically observed at approximately 1-2% oxygen concentration with significant reduction at both higher and lower levels .

What are the most effective methods for monitoring in vivo hydrogenase activity in Bradyrhizobium japonicum?

For in vivo hydrogenase activity monitoring:

  • Amperometric H2 Measurement:

    • Use Clark-type electrodes modified for H2 detection

    • Calibrate with standard H2 concentrations

    • Measure real-time hydrogen consumption in live cultures

  • Isotope Tracing:

    • Employ deuterium (²H) or tritium (³H) labeled hydrogen

    • Track isotope incorporation into metabolites

    • Analyze by mass spectrometry or scintillation counting

  • Gene Expression Reporters:

    • Create transcriptional fusions between hupC promoter and reporter genes

    • Use fluorescent proteins (GFP, mCherry) for real-time monitoring

    • Implement luciferase reporters for high sensitivity

  • Gas Exchange Analysis:

    • Use gas chromatography to measure H2 consumption rates

    • Calculate specific activity (µmol H2/min/mg protein)

    • Monitor CO2 production simultaneously to assess coupling with carbon fixation

  • Colorimetric Whole-Cell Assays:

    • Employ methylene blue or benzyl viologen as artificial electron acceptors

    • Monitor color change spectrophotometrically

    • Calculate activity based on established standard curves

The most reliable method combines multiple approaches, with gas chromatography serving as the gold standard for quantitative measurements of hydrogen consumption rates. Typical hydrogenase activity in wild-type B. japonicum under optimal conditions ranges from 150-300 nmol H2/min/mg protein, while constitutive Hupc mutants may show activities up to 450 nmol H2/min/mg protein regardless of environmental conditions .

How can transcriptomic analysis be applied to identify novel regulatory pathways for hupC expression?

Applying transcriptomic analysis to uncover novel hupC regulatory pathways:

  • Experimental Design for Transcriptomics:

    • Compare gene expression profiles across:

      • Wild-type vs. Hupc mutant strains

      • Various growth conditions (autotrophic, heterotrophic, mixed)

      • Time-course during transition between growth modes

    • Use whole-genome microarrays or RNA-seq with 3+ biological replicates

  • Bioinformatic Analysis Workflow:

    • Quality control: Filter low-quality reads and normalize data

    • Differential expression: Identify significantly altered transcripts using DESeq2 or edgeR

    • Co-expression analysis: Perform clustering to identify genes with similar expression patterns

    • Enrichment analysis: Identify overrepresented pathways or functions

  • Integration with Other Datasets:

    • Combine with ChIP-seq data to identify direct regulatory interactions

    • Correlate with metabolomic data to link regulation to metabolic state

    • Incorporate protein-protein interaction networks

  • Validation Strategy:

    • Confirm key findings with qRT-PCR

    • Generate knockout mutants of candidate regulators

    • Perform promoter analysis of co-regulated genes

In one comprehensive study, whole-genome transcriptional profiling of B. japonicum identified 1,485 differentially expressed transcripts (17.5% of the genome) when comparing chemoautotrophic to heterotrophic cultures. Among the most strongly upregulated genes was a putative isocitrate lyase (aceA; blr2455), suggesting a previously unrecognized role for the glyoxylate cycle during chemoautotrophic growth . This exemplifies how transcriptomic analysis can reveal unexpected regulatory connections.

What methodological considerations are important when designing experiments to characterize the interaction between hupC and other components of the electron transport chain?

When characterizing hupC interactions with electron transport chain components:

  • Protein-Protein Interaction Methods:

    • Co-immunoprecipitation: Use antibodies against hupC to pull down interacting partners

    • Crosslinking: Employ chemical crosslinkers followed by mass spectrometry

    • Blue native PAGE: Preserve native protein complexes for separation and identification

    • FRET/BRET: For in vivo monitoring of protein interactions

  • Electron Transport Analysis:

    • Spectroscopic methods: Absorbance spectra of cytochromes in different oxidation states

    • Potentiometric titrations: Determine redox potentials of electron transfer components

    • Inhibitor studies: Use specific inhibitors to block individual components

  • Structural Biology Approaches:

    • Cryo-EM: For larger complexes and membrane proteins

    • X-ray crystallography: For high-resolution structural information

    • Hydrogen-deuterium exchange mass spectrometry: To map interaction surfaces

  • Molecular Dynamics Simulations:

    • Model electron transfer pathways

    • Predict structural changes during catalytic cycles

    • Simulate effects of mutations on protein-protein interactions

  • Experimental Controls and Validation:

    • Include negative controls (unrelated proteins)

    • Use competition assays to confirm specificity

    • Validate with multiple independent methods

When designing these experiments, researchers should account for the membrane-associated nature of hupC and consider using detergent solubilization methods that preserve protein-protein interactions .

How can researchers optimize experimental conditions to study the role of nickel in hupC function and regulation?

To optimize experimental conditions for studying nickel's role in hupC function:

  • Metal-Free Experimental Environment:

    • Use acid-washed glassware treated with EDTA

    • Prepare media with ultrapure water and analytical grade reagents

    • Test background nickel levels using ICP-MS

  • Nickel Supplementation Strategy:

    • Use NiCl2 or NiSO4 as nickel sources

    • Test concentration range from 0 μM to 5 μM

    • Add at specific growth phases (lag, log, stationary)

  • Analytical Methods for Nickel Quantification:

    • ICP-MS: For precise nickel quantification in media and cells

    • Atomic absorption spectroscopy: Alternative for nickel measurement

    • Colorimetric assays: For rapid screening (e.g., dimethylglyoxime method)

  • Experimental Design:

    • Dose-response studies: Measure hupC expression and hydrogenase activity across nickel concentrations

    • Time-course experiments: Monitor effects of nickel addition at different growth phases

    • Competitive inhibition: Use structural analogs or chelating agents

  • Molecular Studies of Nickel Incorporation:

    • Radioactive 63Ni labeling: Track nickel incorporation into hydrogenase

    • Site-directed mutagenesis: Modify putative nickel-binding residues

    • Heterologous expression: Compare nickel requirements in different hosts

Nickel Concentration (μM)hupC Expression LevelHydrogenase ActivityNi Content in Purified Protein
0DataDataData
0.1DataDataData
0.5DataDataData
1.0DataDataData
2.0DataDataData
5.0DataDataData

Previous studies have shown that wild-type B. japonicum strains show nickel-dependent regulation of hydrogenase expression, with optimum activity at approximately 0.5-1.0 μM nickel concentrations. In contrast, Hupc mutant strains express hydrogenase constitutively regardless of nickel availability, suggesting a defect in the nickel-sensing regulatory mechanism .

What experimental approaches would be most effective for developing engineered hupC variants with enhanced catalytic efficiency?

To develop enhanced hupC variants:

  • Rational Design Approach:

    • Analyze crystal structures or homology models of hupC

    • Identify residues involved in catalysis or electron transfer

    • Design mutations to optimize electron transfer pathways

    • Create a targeted mutation library focusing on:

      • Metal coordination sites

      • Substrate channel residues

      • Interfacial residues for electron transfer partners

  • Directed Evolution Strategy:

    • Create random mutagenesis libraries using error-prone PCR

    • Develop high-throughput screening assays for hydrogenase activity

    • Implement multiple rounds of selection with increasing stringency

    • Combine beneficial mutations through DNA shuffling

  • Computational Design Methods:

    • Use in silico modeling to predict effects of mutations

    • Apply molecular dynamics simulations to assess stability

    • Employ machine learning to identify non-obvious beneficial mutations

    • Design chimeric proteins incorporating domains from related hydrogenases

  • Assay Development for Variant Screening:

    • Create colorimetric assays for rapid screening

    • Develop in vivo selection systems based on growth advantage

    • Implement microfluidic platforms for single-cell analysis

Current wild-type hydrogenase activity in B. japonicum under optimal conditions serves as the baseline (approximately 200-300 nmol H2/min/mg protein). Engineering goals might target 2-5 fold improvements in catalytic rates or enhanced oxygen tolerance for better performance in aerobic conditions .

How can systems biology approaches be applied to understand the integration of hydrogen metabolism with other metabolic pathways in Bradyrhizobium japonicum?

Applying systems biology to understand integrated hydrogen metabolism:

  • Multi-omics Integration Framework:

    • Combine transcriptomic, proteomic, and metabolomic data

    • Develop genome-scale metabolic models of B. japonicum

    • Identify metabolic flux distributions under different growth conditions

    • Map regulatory networks controlling hydrogen metabolism

  • Flux Balance Analysis:

    • Create stoichiometric models of B. japonicum metabolism

    • Perform flux balance analysis to predict optimal flux distributions

    • Validate predictions with 13C metabolic flux analysis

    • Simulate the effects of genetic perturbations

  • Regulatory Network Reconstruction:

    • Identify transcription factors controlling hydrogenase expression

    • Map signal transduction pathways responsive to H2, O2, and Ni

    • Use network analysis to identify regulatory hubs

    • Predict emergent properties of the regulatory network

  • Experimental Validation Methods:

    • Generate knockout strains for key network components

    • Measure metabolic fluxes using isotope labeling

    • Perform growth phenotype arrays under various conditions

    • Test model predictions with targeted experiments

One study highlighted the unexpected upregulation of a putative isocitrate lyase (aceA; blr2455) during chemoautotrophic growth, suggesting an important connection between hydrogen metabolism and the glyoxylate cycle . This exemplifies how systems approaches can reveal non-obvious metabolic connections that merit further investigation.

What are the methodological challenges in translating in vitro findings about hupC to in vivo functions within the symbiotic nodule environment?

Methodological challenges for translating in vitro findings to in vivo nodule environments:

  • Environmental Differences Assessment:

    • Oxygen gradients: Nodules maintain microaerobic conditions that are difficult to replicate in vitro

    • pH variations: Nodule pH may differ from laboratory cultures

    • Carbon/nitrogen balance: Symbiotic environments have unique C/N ratios

    • Plant signaling molecules: Plant-derived compounds may affect hydrogenase expression

  • Experimental Design Considerations:

    • Develop gradient systems to mimic nodule microenvironments

    • Create artificial nodule systems with controlled parameters

    • Implement non-invasive monitoring techniques for live nodules

    • Design split-root experiments to compare treatments

  • In Planta Analysis Methods:

    • Microscopy techniques: Confocal, electron microscopy of nodule sections

    • In situ gene expression: RNA-FISH or in situ hybridization

    • Activity measurements: Hydrogen evolution from intact nodules

    • Proteomics: Isolation of bacteroids for protein analysis

  • Statistical Analysis Approaches:

    • Account for plant-to-plant variability

    • Use mixed-effects models for nested experimental designs

    • Implement proper controls (non-inoculated, mutant comparisons)

    • Calculate effect sizes to quantify biological significance

  • Validation Strategies:

    • Compare multiple plant host species

    • Test under various environmental conditions

    • Use multiple bacterial strain backgrounds

    • Confirm with complementary methodologies

The greatest challenge lies in replicating the complex, dynamic microenvironment of the nodule, where oxygen concentrations, pH, and nutrient availability differ significantly from laboratory conditions. Additionally, plant-derived signals may influence hydrogenase expression in ways not observed in vitro .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.