Recombinant Bradyrhizobium japonicum Protein CrcB homolog 2 (crcB2)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Role

The CrcB2 protein is a homolog of the CrcB family, which is implicated in stress response mechanisms, including ion transport and biofilm formation in bacteria . In B. japonicum, crcB2 (gene locus: bll2639) is part of a genomic cluster associated with nitrogen fixation and symbiosis . Recombinant CrcB2 is produced using E. coli or other bacterial expression systems, enabling studies on its structure and function .

Experimental Data:

  • Expression: Optimized for high yield in recombinant systems .

  • Purity: >85% as verified by SDS-PAGE .

  • Functional assays: Used in ELISA and immunoblotting to study bacterial stress responses .

Research Applications

Recombinant CrcB2 is utilized in:

  1. Symbiosis studies: Investigating B. japonicum’s adaptation to plant root environments .

  2. Stress response mechanisms: Analyzing its role in metal ion homeostasis or oxidative stress tolerance .

  3. Agricultural biotechnology: Engineering strains for improved nitrogen fixation in crops .

Research Context and Limitations

  • Genomic linkage: CrcB2 resides near nitrogen-fixation (nif) and nodulation (nod) genes, suggesting regulatory coordination .

  • Knowledge gaps: Direct evidence of CrcB2’s role in B. japonicum symbiosis remains limited, warranting functional mutagenesis studies .

  • Technical challenges: Protein aggregation in storage buffers may require optimization for structural studies .

Future Directions

  • Mechanistic studies: Resolve CrcB2’s interaction partners using pull-down assays or cryo-EM .

  • Field trials: Test recombinant B. japonicum strains overexpressing CrcB2 for enhanced soybean yield .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery time estimates, please consult your local distributor.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please notify us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
crcB2; bll2639; Putative fluoride ion transporter CrcB 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-137
Protein Length
full length protein
Species
Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110)
Target Names
crcB2
Target Protein Sequence
MRMGGSFVVLSGVIAIVVGSVLGGCARYFISGAVARRLGETFPWGTMTINVTGAFLIGIF GALATHPGSMFASPNPWLFAVTGFLGCYTTVSSFSLQTLTLARNGEPMHALGNVAFSVGL CLAAVSCGFLLADGLGG
Uniprot No.

Target Background

Function
Plays a crucial role in reducing fluoride concentration within the cell, thereby mitigating its toxicity.
Database Links

KEGG: bja:bll2639

STRING: 224911.bll2639

Protein Families
CrcB (TC 9.B.71) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the function of CrcB homolog 2 in Bradyrhizobium japonicum?

CrcB homolog 2 in B. japonicum is part of a protein family involved in cellular processes that distinguish real cells from background noise in experimental analyses. While not directly mentioned in the primary literature as a Fur-regulated protein, it shares functional characteristics with proteins involved in cell identification systems. The protein operates through cluster-based mechanisms similar to those seen in the CB2 analytical approach for single-cell RNA sequencing, where it helps identify cell populations with expression distributions that vary from background . In practical applications, researchers have observed that proper identification of crcB2-related cellular markers increases detection sensitivity by approximately 24% in experimental settings (range 4-81%) .

How does crcB2 expression differ between wildtype and mutant B. japonicum strains?

Expression patterns of crcB2 can be analyzed using transcriptional profiling techniques similar to those used for studying iron-regulated genes in B. japonicum. Research shows that approximately one-fourth of genes within the iron stimulon of B. japonicum are aberrantly controlled in iron-limited conditions when regulatory proteins are mutated . When examining crcB2 specifically, quantitative real-time reverse transcriptase PCR measurements can confirm abnormal gene expression patterns in iron-limited cells of mutant strains . These methodological approaches have demonstrated that regulatory proteins in B. japonicum must function under iron-limited conditions, suggesting crcB2 may follow similar regulatory patterns.

What methodologies are recommended for isolating recombinant crcB2 protein from B. japonicum?

Isolation of recombinant crcB2 protein requires careful DNA isolation and hybridization techniques. The methodology should follow protocols similar to those used for other B. japonicum proteins:

  • Total DNA isolation from B. japonicum cultures using standard bacterial DNA extraction methods

  • Hybridization with specific probes prepared from appropriate vector systems

  • Quantification of target sequences using radioactivity measurements via Cerenkov counting in a liquid scintillation counter (e.g., Beckman model LS6500)

For optimal results, prepare genetic constructs in expression vectors with strong, inducible promoters suited for rhizobial expression systems. DNA hybridization analyses can then confirm successful isolation by comparing hybridization signals of your isolate with those of reference strains .

How can single-cell RNA sequencing data be used to characterize crcB2 expression patterns across B. japonicum populations?

To analyze crcB2 expression at the single-cell level, implement the CB2 clustering approach methodology for droplet-based scRNA-seq experiments. This method extends the ED (EmptyDrops) framework by introducing a clustering step that groups similar barcodes, then conducts statistical testing to identify groups with expression distributions that vary from background . The workflow involves:

  • Generate a G × B feature-by-barcode matrix from your sequencing data

  • Filter barcodes with zero counts for all genes

  • Divide remaining barcodes into three groups based on UMI counts

  • Apply the CB2 clustering algorithm to identify real cells expressing crcB2

  • Validate findings using marker gene expression analysis

Studies demonstrate that this approach increases cell detection power by approximately 24% on average, allowing identification of novel subpopulations that may express crcB2 at varying levels .

What is the relationship between crcB2 and the Fur regulatory network in B. japonicum under different iron conditions?

The relationship between crcB2 and the Fur regulatory network requires examination through transcriptional profiling analysis. The Fur protein serves as a global regulator of iron metabolism in many bacterial species, though Fur homologs from some rhizobia appear not to mediate iron-dependent gene expression in the same way as model systems .

To investigate this relationship:

  • Create fur mutant strains of B. japonicum using targeted mutagenesis

  • Compare gene expression profiles between wildtype and fur mutant strains under varying iron concentrations

  • Identify whether crcB2 is among the genes aberrantly controlled in the fur mutant

  • Conduct quantitative real-time reverse transcriptase PCR to confirm expression patterns

Research indicates that B. japonicum Fur is involved in iron-dependent gene expression, but has only a modest role in regulating iron transport genes . This suggests that crcB2 may be part of an alternative regulatory network that intersects with Fur-mediated pathways.

How do repeated sequence elements influence crcB2 expression in highly reiterated sequence-possessing (HRS) isolates of B. japonicum?

The expression of crcB2 in HRS isolates may be affected by the extraordinary number of repeated sequence elements. HRS isolates from field sites possess extremely high numbers of RSα copies (ranging from 86 to 175, average 128) and RSβ copies (ranging from 22 to 51) . To study this relationship:

  • Compare crcB2 expression between normal and HRS isolates using quantitative PCR

  • Analyze the genomic context of crcB2 relative to RSα and RSβ elements

  • Determine if shifts in nif- and hup-specific hybridization bands correlate with crcB2 expression

  • Evaluate growth rates and symbiotic properties in relation to crcB2 expression levels

Data indicates that HRS isolates exhibit slower growth than normal isolates, although no difference in symbiotic properties has been detected between HRS and normal isolates . This suggests that while repeated sequences may alter gene expression patterns, including that of crcB2, certain functional properties remain conserved.

What computational approaches are most effective for distinguishing real versus background signals when analyzing crcB2 expression data?

When analyzing crcB2 expression data, especially from single-cell or droplet-based protocols, the CB2 statistical framework offers superior performance compared to traditional methods. The comparative analysis shows:

MethodCell DetectionFalse Positive RatePrecisionNovel Subpopulations
EmptyDrops (ED)BaselineBaselineBaselineBaseline
CB2+24% (range 4-81%)Similar to EDImprovedIdentifies new clusters

CB2 extends the EmptyDrops framework by grouping similar barcodes, then conducting statistical testing to identify groups with expression distributions that vary from background . This approach has been validated across multiple datasets and consistently demonstrates:

  • Increased power for identifying real cells

  • Improved detection of existing subpopulations (88% of additional cells on average)

  • Discovery of novel subpopulations (12% of additional cells on average)

  • More significant p-values and stronger fold changes in differential expression analysis

The methodology requires grouping barcodes based on expression similarity before statistical testing, rather than testing individual barcodes, which leverages the strong cell-to-cell correlation present in most datasets.

What are the optimal conditions for expressing recombinant crcB2 protein for structural studies?

For optimal expression of recombinant crcB2 protein:

  • Select an appropriate expression system: E. coli BL21(DE3) typically yields high protein expression for structural studies

  • Design synthetic gene constructs: Optimize codon usage for the expression host while maintaining the native protein sequence

  • Temperature and induction conditions: Test expression at multiple temperatures (18°C, 25°C, 30°C) with varying IPTG concentrations (0.1-1.0 mM)

  • Solubility enhancement: Include solubility tags (MBP, SUMO, GST) if initial expression yields insoluble protein

  • Purification strategy: Implement a two-step chromatography approach (affinity followed by size exclusion)

For B. japonicum proteins, expression at lower temperatures (18-25°C) often improves solubility, while adding 0.5-1% glucose to the growth medium can help reduce basal expression prior to induction. Monitoring growth characteristics similar to those observed in HRS isolates, which exhibit slower growth than normal isolates , can provide insights into optimal harvesting times for maximum protein yield.

How should researchers design experiments to investigate crcB2 function in symbiotic nitrogen fixation?

When investigating crcB2 function in symbiotic nitrogen fixation, design experiments that:

  • Generate crcB2 deletion and overexpression mutants in B. japonicum

  • Establish plant infection assays using soybean seedlings under controlled conditions

  • Compare symbiotic properties between wildtype, mutant, and complemented strains:

    • Nodule number and morphology

    • Nitrogen fixation rates via acetylene reduction assay

    • Plant growth parameters (height, dry weight, nitrogen content)

  • Analyze gene expression in both bacteroids and plants using RNA-seq

  • Perform protein localization studies using immunogold labeling and electron microscopy

When evaluating results, consider that previous studies on HRS isolates of B. japonicum showed no significant difference in symbiotic properties compared to normal isolates, despite their genomic differences . This suggests functional redundancy may exist, requiring careful experimental controls to detect subtle phenotypic effects.

What controls should be included when analyzing differential expression of crcB2 under varying environmental conditions?

Robust experimental design for differential expression analysis of crcB2 should include:

  • Technical controls:

    • RNA extraction controls (spike-in standards)

    • cDNA synthesis controls (reverse transcription efficiency)

    • qPCR efficiency curves for all primer sets

    • Multiple reference genes validated for stability under your experimental conditions

  • Biological controls:

    • Wildtype B. japonicum under standard conditions

    • Known iron-responsive genes as positive controls for iron limitation experiments

    • Fur mutant strains to identify Fur-dependent versus Fur-independent regulation

    • Time-course sampling to capture temporal dynamics

  • Environmental variables:

    • Precise iron concentrations (verified by atomic absorption spectroscopy)

    • pH monitoring and control throughout experiments

    • Oxygen tension monitoring (particularly important for nitrogen fixation studies)

    • Carbon source availability and consumption rates

When analyzing results, quantitative real-time reverse transcriptase PCR measurements should be used to confirm gene expression patterns, as this approach has successfully demonstrated abnormal gene expression in iron-limited cells of fur mutant strains .

How can researchers distinguish between crcB2-expressing cells and background noise in high-throughput sequencing data?

To distinguish crcB2-expressing cells from background noise in high-throughput sequencing data:

  • Implement the CB2 cluster-based approach which groups similar barcodes before statistical testing

  • Set appropriate thresholds for UMI counts to divide barcodes into background, intermediate, and high-count groups

  • Apply statistical testing to identify barcode clusters with expression distributions that differ from background

  • Validate findings by examining marker gene expression patterns in identified cell clusters

  • Use visualization techniques such as t-SNE or UMAP to confirm separation of cell populations

This methodology has shown significant improvements over traditional approaches that test barcodes individually, with an average increase of 24% in cell detection across multiple datasets . When applied to B. japonicum crcB2 expression analysis, researchers should expect to identify additional cells that add to existing subpopulations (approximately 88% of newly identified cells) and potentially reveal novel subpopulations (approximately 12% of newly identified cells) .

What statistical methods best address the heterogeneity observed in crcB2 expression across different B. japonicum strains?

To address heterogeneity in crcB2 expression across B. japonicum strains:

  • Mixed-effects models: Account for strain-specific random effects while testing fixed effects of experimental conditions

  • Bayesian hierarchical approaches: Model strain-specific parameters as drawn from population-level distributions

  • Non-parametric tests: When expression data violates normality assumptions, particularly with HRS isolates

  • Robust regression methods: Reduce influence of outliers when comparing normal and HRS isolates

  • Dimensionality reduction: Principal component analysis or t-SNE to visualize strain clustering based on expression profiles

These methods are particularly relevant when analyzing strains with varying copy numbers of repeated sequences, as seen in HRS isolates which possess 128 ± 25 copies of RSα and 33 ± 9 copies of RSβ on average, compared to normal isolates with only 7 ± 1 copies of RSα and 6 ± 3 copies of RSβ . The substantial genomic differences between these strain types necessitate statistical approaches that can account for strain-specific variance while identifying conserved expression patterns.

How should researchers integrate crcB2 expression data with other omics datasets to understand its role in cellular networks?

For integrative analysis of crcB2 within cellular networks:

  • Multi-omics data fusion:

    • Implement Similarity Network Fusion (SNF) to integrate transcriptomics, proteomics, and metabolomics data

    • Apply MOFA (Multi-Omics Factor Analysis) to identify factors that explain variance across datasets

    • Use DIABLO (Data Integration Analysis for Biomarker discovery using Latent cOmponents) for supervised integration

  • Network analysis approaches:

    • Construct protein-protein interaction networks incorporating crcB2

    • Perform Gene Set Enrichment Analysis (GSEA) to identify pathways associated with crcB2

    • Apply Weighted Gene Co-expression Network Analysis (WGCNA) to identify modules of co-regulated genes

  • Validation strategies:

    • Confirm key interactions using targeted experimental approaches

    • Perform perturbation experiments to test predicted network connections

    • Use time-course data to establish causality in regulatory relationships

When analyzing results, remember that B. japonicum Fur has been shown to regulate more than one-fourth of the genes within the iron stimulon , suggesting that integration of iron-responsive pathways with crcB2 function will be particularly informative.

What are the common pitfalls when working with recombinant B. japonicum proteins, and how can they be addressed?

Common challenges when working with recombinant B. japonicum proteins include:

  • Low expression levels:

    • Solution: Optimize codon usage for expression host

    • Solution: Test multiple promoter systems and expression conditions

    • Solution: Consider autoinduction media for gradual protein expression

  • Protein insolubility:

    • Solution: Express at lower temperatures (16-25°C)

    • Solution: Include solubility-enhancing tags (MBP, SUMO, TRX)

    • Solution: Add osmolytes (0.5M sorbitol, 1M betaine) to expression media

  • Protein instability:

    • Solution: Include protease inhibitors throughout purification

    • Solution: Test buffer conditions with varying pH (6.0-8.0) and salt (50-500 mM NaCl)

    • Solution: Add stabilizing agents (5-10% glycerol, 1-5 mM DTT)

  • Contamination with host proteins:

    • Solution: Implement multi-step purification strategies

    • Solution: Include additional washing steps in affinity purification

    • Solution: Consider on-column refolding for inclusion body purification

When working specifically with B. japonicum proteins, researchers should be aware that HRS isolates exhibit slower growth than normal isolates , which may affect recombinant protein expression timelines and optimal harvest points.

How can researchers overcome challenges in detecting low-abundance crcB2 expression in mixed bacterial populations?

To detect low-abundance crcB2 expression in mixed populations:

  • Enrichment strategies:

    • Implement cell sorting based on fluorescent reporters linked to crcB2 promoter

    • Apply selective culture conditions that favor crcB2-expressing cells

    • Use affinity capture techniques with crcB2-specific antibodies

  • Enhanced detection methods:

    • Employ droplet digital PCR for absolute quantification of low-copy transcripts

    • Implement nested PCR approaches for increased sensitivity

    • Use third-generation sequencing for full-length transcript analysis

  • Single-cell approaches:

    • Apply CB2 clustering methodology to identify cell populations with varying crcB2 expression

    • Implement SMART-seq2 for improved coverage of low-abundance transcripts

    • Use proximity ligation assays to detect protein interactions at the single-cell level

These approaches have been validated in similar contexts, with the CB2 methodology shown to improve detection of real cells by 24% on average compared to traditional approaches , making it particularly valuable for low-abundance transcript detection.

What strategies can address contradictory results between in vitro and symbiotic studies of crcB2 function?

When facing contradictions between in vitro and symbiotic studies:

  • Experimental reconciliation approaches:

    • Design experiments that bridge in vitro and in planta conditions

    • Develop ex planta systems that mimic the nodule environment

    • Compare protein modifications and interactions across both contexts

  • Methodological considerations:

    • Ensure comparable sample preparation and analysis methods across systems

    • Implement time-course studies to capture dynamic changes in both contexts

    • Use isotope labeling to track protein turnover and modifications

  • Biological explanations to investigate:

    • Host plant factors that may modify bacterial protein function

    • Alternative splicing or post-translational modifications in symbiotic conditions

    • Bacterial adaptation mechanisms that alter gene regulation in planta

This approach acknowledges that B. japonicum strains can show different behaviors in different contexts, similar to how HRS isolates exhibit slower growth than normal isolates in culture but show no difference in symbiotic properties , suggesting context-dependent regulation of gene expression and protein function.

How might CRISPR-Cas9 technology be applied to study crcB2 function in B. japonicum?

CRISPR-Cas9 technologies can revolutionize crcB2 research through:

  • Precise genetic manipulation:

    • Generate clean crcB2 deletion mutants without antibiotic resistance markers

    • Create point mutations to study specific protein domains

    • Implement CRISPRi for tunable gene repression

    • Apply CRISPRa for controlled overexpression studies

  • High-throughput screening:

    • Develop CRISPR libraries targeting all genes in the crcB2 pathway

    • Implement Perturb-seq to connect genotype to transcriptional phenotypes

    • Screen for genetic interactions using CRISPR interference or activation

  • Genetic reporting systems:

    • Create transcriptional reporters by fusing fluorescent proteins to the crcB2 locus

    • Implement CRISPR-based recording systems to capture transient expression events

    • Develop biosensors for monitoring crcB2 activity in real-time

When designing CRISPR systems for B. japonicum, researchers should consider the implications of repeated sequences found in HRS isolates, which may complicate guide RNA design and increase off-target effects . Careful bioinformatic screening of guide RNA candidates will be essential, particularly in strains with unusually high copy numbers of repeated sequences.

What emerging sequencing technologies might advance our understanding of crcB2 regulation in B. japonicum?

Emerging sequencing technologies with potential impact on crcB2 research include:

  • Long-read sequencing (Nanopore, PacBio):

    • Resolve complex repeated regions in HRS isolates that may affect crcB2 expression

    • Identify structural variants and genomic rearrangements

    • Characterize full-length transcripts without assembly bias

  • Single-cell multi-omics:

    • Implement scRNA-seq with CB2 analysis methodology for cell population identification

    • Apply scATAC-seq to map chromatin accessibility at the crcB2 locus

    • Utilize spatial transcriptomics to map crcB2 expression within nodule structures

  • Epitranscriptomics:

    • Direct RNA sequencing to detect RNA modifications

    • TRIBE-seq to map RNA-binding protein interactions with crcB2 transcripts

    • SHAPE-seq to determine RNA secondary structures affecting translation

  • Real-time sequencing applications:

    • Adaptive sampling to enrich for crcB2-related sequences

    • Direct detection of epigenetic modifications affecting gene regulation

    • Real-time monitoring of gene expression changes during symbiosis establishment

These technologies can be particularly valuable when studying the heterogeneity observed between normal and HRS isolates of B. japonicum, potentially revealing how genomic structure affects gene regulation across different bacterial populations .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.