Recombinant Bradyrhizobium japonicum UPF0283 membrane protein blr7254 (blr7254)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Bradyrhizobium japonicum UPF0283 membrane protein Blr7254 (Blr7254) is a full-length protein derived from the nitrogen-fixing soil bacterium Bradyrhizobium japonicum, a key symbiotic partner of leguminous plants such as soybean. This protein is annotated under the UniProt ID Q89E33 and is classified within the UPF0283 family, a group of conserved but functionally uncharacterized membrane proteins found in bacteria. The recombinant form is engineered for research applications, featuring an N-terminal His-tag for purification and detection.

Recombinant Production and Purification

The protein is produced via heterologous expression in E. coli, leveraging the robustness of this system for high-yield soluble protein synthesis. Key steps include:

  1. Cloning: The blr7254 gene (locus tag: blr7254) is cloned into an expression vector under a strong promoter.

  2. Expression: Induced using IPTG or arabinose, depending on the vector system.

  3. Purification: Affinity chromatography using Ni²⁺-NTA resin to exploit the His-tag, followed by size-exclusion chromatography for polishing.

  4. Quality control: Validated by SDS-PAGE and mass spectrometry for identity and purity.

Functional Insights and Hypotheses

While the precise biological role of Blr7254 remains uncharacterized, its homology to the UPF0283 family suggests potential involvement in:

  • Membrane transport: Structural motifs imply roles in small-molecule or ion transport.

  • Stress adaptation: UPF0283 proteins in other bacteria are upregulated under nutrient limitation or oxidative stress.

  • Symbiosis support: Given B. japonicum’s role in root nodulation, Blr7254 may contribute to host-microbe signaling or nutrient exchange.

Table 2: Comparative Analysis of UPF0283 Family Proteins

OrganismProteinFunction (Hypothesized)Reference
B. japonicumBlr7254Membrane transportUniProt Q89E33
E. coliYeaZStress responsePMID: 12356730
Bacillus subtilisYvlCCell wall metabolismPMID: 19880642

Research Applications

Recombinant Blr7254 is primarily used in:

  • Structural biology: Crystallization trials to resolve 3D architecture.

  • Antibody development: Immunization for generating monoclonal/polyclonal antibodies.

  • Functional assays: Reconstitution into liposomes to study transport activity.

Challenges and Future Directions

  • Functional elucidation: Targeted knockouts in B. japonicum could clarify its role in symbiosis or metabolism.

  • Interactome studies: Identification of binding partners via pull-down assays.

  • Biotechnological potential: Engineering blr7254 expression to enhance rhizobial efficiency in agriculture.

References

  1. Creative BioMart. (2025). Recombinant Full Length Bradyrhizobium japonicum UPF0283 Membrane Protein Blr7254. [Online] Available: https://www.creativebiomart.net .

  2. Gene Bio Systems. (2024). Recombinant Bradyrhizobium japonicum UPF0283 Membrane Protein Blr7254. [Online] Available: https://www.genebiosystems.com .

  3. UniProt Consortium. (2025). Entry Q89E33 (UPF0283 membrane protein blr7254). [Online] Available: https://www.uniprot.org.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference in the order notes. We will accommodate your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery estimates, please contact your local distributor.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, it is recommended to briefly centrifuge the vial prior to opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life of our proteins depends on various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize development of the specified tag.
Synonyms
blr7254; UPF0283 membrane protein blr7254
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-343
Protein Length
full length protein
Species
Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110)
Target Names
blr7254
Target Protein Sequence
MNERSPPRRPATFRLDDPGVVVTEADETARLGRGTIQITPEHDPATLPVPIEAVLPARRG LPWGALFWSGLAGLTLLGVGLGVVHLIEDLFARSESLGFVGLAFAFVTALALAVVIGREA YGLARLATIEKLHQRAAAVLASDDRKESRVIVQDLLKIAHQNPQLARARATLESHTGEII DGADMIRLAERELMSPLDAEARRLVSSAAQKVSIVTAVSPRAAIDVMFVFVAALRLIRQL AYLYGGRPGALGMIRLLRHVIAHLAITGGMAASDSLVQQMLGHGIAAKLSQRLGEGVLNG LLTARLGLAAIEVTRPLPFAALPPPKLSDLATDLLRKKEDEEE
Uniprot No.

Target Background

Database Links

KEGG: bja:blr7254

STRING: 224911.blr7254

Protein Families
UPF0283 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Bradyrhizobium japonicum and why is it significant in research?

Bradyrhizobium japonicum is a species of legume-root nodulating, microsymbiotic nitrogen-fixing bacteria. It belongs to the broader classification of rhizobia, which are Gram-negative, rod-shaped bacteria. Taxonomically, it belongs to homology group II based on DNA sequencing studies . The significance of B. japonicum in research stems from its nitrogen-fixing capabilities, which make it invaluable in agricultural applications and as a model organism for studying plant-microbe symbiotic relationships. The strain USDA110 has been used as a model organism since 1957 due to its superior symbiotic nitrogen-fixation activity with soybean compared to other rhizobia species .

What genomic resources are available for studying the blr7254 gene?

The complete genome of B. japonicum USDA110 was sequenced in 2002, revealing a single circular chromosome with 9,105,828 base pairs . This genomic information provides a valuable resource for studying the blr7254 gene within its genomic context. Researchers can access this genomic data through databases like GenBank or specialized rhizobial genome databases. For genetic manipulation and study, various molecular tools have been developed specifically for Bradyrhizobium, including shuttle vectors, expression systems, and knockout methodologies. When planning experiments involving blr7254, researchers should reference the latest genome annotation to ensure accurate primer design and genetic manipulation strategies.

Which expression systems are most effective for recombinant blr7254 protein production?

Recombinant UPF0283 membrane protein blr7254 can be expressed in various host systems, with E. coli and yeast providing the best yields and shorter turnaround times . The choice of expression system depends on research requirements:

The optimal choice depends on the specific experimental requirements, particularly whether post-translational modifications are essential for the research questions being addressed.

What are the methodological considerations for purifying recombinant blr7254?

Purification of recombinant blr7254 requires careful consideration of its membrane protein characteristics. The following methodology is recommended:

  • Cell lysis optimization: Gentle lysis methods such as enzymatic treatment or freeze-thaw cycles may preserve membrane protein structure better than sonication.

  • Detergent selection: Screen multiple detergents (e.g., DDM, LDAO, or C12E8) for optimal solubilization without denaturing the protein. A detergent screening table is essential:

DetergentCMC (mM)Working ConcentrationProtein StabilityExtraction Efficiency
DDM0.171-2% (w/v)HighModerate
LDAO1-21% (w/v)ModerateHigh
C12E80.080.5-1% (w/v)HighModerate
Triton X-1000.2-0.91% (v/v)ModerateHigh
  • Affinity chromatography: His-tag or other affinity tags can facilitate purification, though tag positioning is critical for membrane proteins.

  • Size exclusion chromatography: As a final purification step to ensure protein homogeneity and remove aggregates.

  • Stability assessment: Regular monitoring of protein stability through activity assays or structural analyses during purification is essential.

Each step requires optimization specifically for blr7254 to maintain its native conformation and activity.

What techniques are most effective for determining the structure of blr7254?

Determining the structure of membrane proteins like blr7254 presents unique challenges. A multi-technique approach is recommended:

  • X-ray crystallography: Requires obtaining well-diffracting crystals, which can be challenging for membrane proteins. Lipidic cubic phase (LCP) crystallization has proven successful for many membrane proteins.

  • Cryo-electron microscopy (cryo-EM): Particularly valuable for membrane proteins as it doesn't require crystallization. Recent advances in detector technology and processing algorithms have dramatically improved resolution.

  • NMR spectroscopy: Useful for studying dynamics but typically limited to smaller proteins or domains.

  • Computational modeling: When experimental structures are unavailable, homology modeling using related protein structures can provide structural insights.

Each method has distinct advantages and limitations. The table below summarizes their applicability to blr7254 characterization:

TechniqueResolution PotentialSample RequirementsAdvantages for blr7254Limitations
X-ray crystallographyHigh (1-3 Å)Milligram quantities of pure, homogeneous proteinAtomic resolutionCrystallization challenges
Cryo-EMMedium-High (2-4 Å)Microgram quantitiesNo crystallization requiredSize limitations (less effective for <100 kDa)
NMRMedium (domains)Milligram quantities, isotopically labeledDynamic informationSize limitations (difficult for >30 kDa)
Computational modelingVariableExisting structures of homologous proteinsAccessible, low costAccuracy depends on template quality

How can the membrane topology of blr7254 be experimentally determined?

Membrane topology determination is critical for understanding blr7254 function. Multiple complementary approaches should be employed:

  • Cysteine scanning mutagenesis: Systematically replace amino acids with cysteine and test accessibility to membrane-impermeable reagents.

  • Protease protection assays: Limited proteolysis combined with mass spectrometry to identify exposed regions.

  • Fluorescence techniques: Fusion of GFP or other fluorescent proteins to determine orientation.

  • Computational prediction: Use of topology prediction algorithms as a starting point for experimental design.

Data from these approaches should be integrated to develop a consensus topology model, which can then guide further functional studies.

What are the optimal conditions for studying blr7254 function in B. japonicum?

To study blr7254 function in B. japonicum, consider the following experimental conditions:

  • Growth medium: HM medium (Cole and Elkan, 1973) is commonly used for Bradyrhizobium culture . For specific studies of membrane protein function, this can be supplemented with 0.1% (w/v) arabinose and 0.025% (w/v) yeast extract to activate bacterial cells .

  • Culture conditions: Maintain cultures at 28°C, which is optimal for Bradyrhizobium growth . For slower-growing Bradyrhizobium species, extend incubation periods up to 10 days for colony formation .

  • Isolation strategy: When isolating strains expressing blr7254, consider that Bradyrhizobium species are oligotrophic slow-growing bacteria that are resistant to polymyxin B . This characteristic can be exploited for selective isolation.

  • Genetic manipulation: For gene knockout or overexpression studies, established methods for Bradyrhizobium transformation should be employed, with modifications specific to membrane protein genes.

What methodologies are recommended for assessing blr7254 involvement in nitrogen fixation?

To evaluate blr7254's potential role in nitrogen fixation:

  • Acetylene reduction assay: A well-established method for quantifying nitrogenase activity. The procedure involves:

    • Pre-culture in HM medium at 28°C

    • Collection of cells by centrifugation (13,000 × g, 3 min, 4°C)

    • Washing twice with sterilized water

    • Inoculation into Rennie semi-solid medium

    • Incubation at 28°C for 3 days

    • Replacement of 10% gas phase with acetylene

    • Re-incubation for 3 days

    • Measurement of ethylene production by gas chromatography

  • 15N isotope incorporation studies: To directly measure nitrogen fixation rates.

  • Gene knockout/knockdown studies: Compare nitrogen fixation capabilities between wild-type and blr7254 mutants.

  • Transcriptomics/proteomics: Analyze expression patterns under nitrogen-fixing versus non-fixing conditions.

How can blr7254 be genetically modified to enhance nitrogen fixation capabilities?

Genetic modification of blr7254 for enhanced nitrogen fixation requires:

  • Structure-function analysis: Identify critical domains through systematic mutagenesis.

  • Directed evolution: Apply selective pressure to generate variants with improved function.

  • Domain swapping: Exchange domains with homologous proteins from highly efficient nitrogen-fixing strains.

  • Promoter engineering: Modify expression levels through promoter substitution or enhancement.

When designing modifications, consider the role of this membrane protein in the broader context of nitrogen fixation pathways, particularly its potential interactions with the FixJ-FixK2-FixK1 cascade that senses oxygen gradients and regulates nitrogen respiration genes .

What approaches can be used to study the interaction partners of blr7254 in vivo?

Understanding blr7254's interaction network is crucial for deciphering its function. Consider these approaches:

  • Crosslinking coupled with mass spectrometry: Chemical crosslinking followed by proteomic analysis can identify proximal proteins.

  • Co-immunoprecipitation: Using antibodies against tagged blr7254 or native protein.

  • Bacterial two-hybrid systems: Adapted for membrane protein interactions.

  • FRET-based assays: For monitoring dynamic interactions in living cells.

  • In situ proximity labeling: Methods like BioID or APEX2 can identify the proximity interactome.

Data from these methods should be compared with genomic context analysis, as genes with related functions often cluster together in bacterial genomes.

What are the common challenges in expressing recombinant blr7254 and how can they be addressed?

Membrane protein expression presents several challenges. The table below outlines common issues with blr7254 expression and recommended solutions:

ChallengePossible CausesSolutions
Low expressionCodon bias, toxicity to hostOptimize codons, use inducible promoters, lower induction temperature
Protein aggregationImproper folding, overexpressionReduce expression rate, co-express chaperones, use fusion partners
DegradationProtease activityInclude protease inhibitors, use protease-deficient strains
Insufficient solubilizationInadequate detergent selectionScreen multiple detergents, optimize detergent concentration
Loss of functionDenaturation during purificationGentler purification conditions, activity assays at each step

For blr7254 specifically, expression in insect cells or mammalian cells may provide better results when proper folding and post-translational modifications are critical for the research application .

How can researchers ensure the recombinant blr7254 retains its native conformation and function?

To ensure recombinant blr7254 maintains native properties:

  • Functional assays: Develop assays specific to the proposed function of blr7254.

  • Structural validation: Use circular dichroism or thermal shift assays to compare recombinant protein folding with native samples.

  • Reconstitution in lipid environments: Test function after incorporation into liposomes or nanodiscs that mimic the native membrane environment.

  • Expression system selection: Consider that proper post-translational modifications may be necessary for correct protein folding or retention of activity .

  • Gentle purification protocols: Minimize protein denaturation through optimized buffers and mild detergents.

How should researchers analyze sequence conservation of blr7254 across different Bradyrhizobium species?

Sequence conservation analysis provides insights into functionally important regions. Follow these steps:

  • Multiple sequence alignment: Align blr7254 homologs from diverse Bradyrhizobium species using tools like MUSCLE or CLUSTALW.

  • Conservation scoring: Calculate position-specific conservation scores using algorithms like ConSurf.

  • Structural mapping: Map conservation onto structural models to identify surface clusters of conserved residues.

  • Functional domain prediction: Correlate conservation patterns with predicted functional domains.

  • Evolutionary analysis: Perform phylogenetic analysis to understand evolutionary relationships between homologs.

A comprehensive analysis should include homologs from both closely related strains and more distant relatives to distinguish generally conserved features from species-specific adaptations.

What statistical approaches are appropriate for analyzing blr7254 expression data under different conditions?

When analyzing expression data:

  • Normalization: Account for technical variations using appropriate normalization methods (e.g., RPKM for RNA-seq data).

  • Statistical testing: Apply appropriate tests based on experimental design:

    • t-tests or ANOVA for simple comparisons

    • Linear models for complex designs

    • Non-parametric tests when normality assumptions are violated

  • Multiple testing correction: Use methods like Benjamini-Hochberg to control false discovery rate.

  • Correlation analysis: When studying relationships between blr7254 expression and other variables (e.g., nitrogen fixation rates).

  • Data visualization: Present results using clear, informative visualizations that highlight patterns and significant differences.

Consider the unique aspects of membrane protein gene expression, which may exhibit different patterns compared to cytosolic proteins.

What emerging technologies could advance our understanding of blr7254 function?

Several cutting-edge approaches show promise for blr7254 research:

  • Cryo-electron tomography: For visualizing membrane proteins in their native cellular context.

  • Single-molecule studies: To observe conformational changes and dynamic processes.

  • Genome editing with CRISPR-Cas systems: For precise genetic manipulation in Bradyrhizobium.

  • Microfluidics-based assays: For high-throughput screening of conditions affecting blr7254 function.

  • Integrative structural biology: Combining multiple structural methods for comprehensive characterization.

These emerging technologies may help overcome the current limitations in membrane protein research and provide new insights into blr7254 function.

How might blr7254 research contribute to sustainable agriculture applications?

The potential agricultural applications of blr7254 research include:

  • Enhanced biofertilizers: Engineering improved Bradyrhizobium strains with optimized nitrogen fixation capabilities.

  • Reduced reliance on synthetic fertilizers: The benefits of B. japonicum strain inoculation are potentially greater than nitrogen fertilizers, which could reduce farmers' expenditure on inorganic fertilizers and mitigate negative environmental effects .

  • Crop-specific symbiotic optimization: Tailoring Bradyrhizobium strains for specific crops beyond soybeans, such as Bambara groundnut accessions as studied in field experiments in Nigeria .

  • Bioremediation applications: Exploiting the metabolic capabilities of modified strains for environmental cleanup.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.