Recombinant Bradyrhizobium japonicum UPF0314 protein bll0647 (bll0647)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
bll0647; UPF0314 protein bll0647
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-205
Protein Length
full length protein
Species
Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110)
Target Names
bll0647
Target Protein Sequence
MTLATTHESKAAVPAFAWVSIALLLLALQASILFAMGRVPICTCGYVKLWHGVVNSSENS QHIADWYSFSHVLHGFLFYGLTFLLFARLPLLPLSWPARLIVAMLIEGAWEIVENSPFII ERYRAGTISLDYFGDSIVNSVSDNLAMVLGFLAARVLPVWVTVMIGLAFEIMLALHIRDN LTLNILMLIHPIEAVKQWQSGPPII
Uniprot No.

Target Background

Database Links

KEGG: bja:bll0647

STRING: 224911.bll0647

Protein Families
UPF0314 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is UPF0314 protein bll0647?

UPF0314 protein bll0647 is a protein encoded by the gene locus bll0647 in the Bradyrhizobium japonicum USDA 110 genome. It belongs to the UPF0314 protein family, which comprises uncharacterized proteins with conserved domains across various bacterial species. The "UPF" designation indicates an uncharacterized protein family whose precise biological function has not been fully elucidated through experimental validation. In research contexts, the recombinant form typically represents a partial sequence corresponding to amino acids 1-205 of the full-length protein .

What is the predicted molecular weight and structure of bll0647?

Based on the amino acid sequence of the partial recombinant bll0647 protein (amino acids 1-205), the predicted molecular weight is approximately 23 kDa. This estimation derives from the amino acid composition and does not account for potential post-translational modifications. Structural prediction analysis suggests the protein contains hydrophobic regions consistent with transmembrane domains, indicating it may be membrane-associated . While no experimentally determined structure (via X-ray crystallography or NMR spectroscopy) is reported in the search results, computational methods can generate theoretical models to guide functional studies.

Which expression systems are optimal for recombinant bll0647 production?

Multiple expression systems can be employed for producing recombinant bll0647, with varying advantages based on research requirements:

Expression SystemAdvantagesConsiderationsRelative Yield
E. coli- Highest yield
- Rapid growth
- Cost-effective
- Limited post-translational modificationsHighest
Yeast (P. pastoris, S. cerevisiae)- Eukaryotic processing
- Better folding machinery
- Longer production timeHigh
Insect cells (Baculovirus)- Advanced post-translational modifications- Higher cost
- Technical expertise required
Moderate
Mammalian cells- Most sophisticated modifications
- Native-like folding
- Expensive
- Low yield
Lowest

E. coli and yeast systems offer the best yields and shorter turnaround times for bll0647 production . The choice depends on whether post-translational modifications are necessary for the protein's activity or experimental applications .

What purification strategy yields highest purity recombinant bll0647?

The optimal purification strategy for recombinant bll0647 employs a multi-step approach to achieve high purity:

  • Affinity Chromatography: The primary purification step utilizing affinity tags (His-tag, GST, MBP) expressed with the protein. His-tagged bll0647 can be purified using immobilized metal affinity chromatography (IMAC) with Ni-NTA or Co-NTA resins.

  • Size Exclusion Chromatography: A secondary purification step that removes aggregates and improves homogeneity by separating proteins based on molecular size.

  • Ion Exchange Chromatography: An additional step that can be employed based on the protein's isoelectric point to remove contaminants with different charge properties.

For applications requiring extremely high purity, such as structural studies or sensitive functional assays, a combination of these methods is recommended. The purification protocol should be optimized based on the specific construct design and intended downstream applications.

What are the optimal storage conditions for purified bll0647?

Purified recombinant bll0647 protein should be stored in a Tris-based buffer supplemented with 50% glycerol . The optimal storage conditions are:

  • Short-term storage (≤1 week): 4°C in working aliquots

  • Long-term storage: -20°C or -80°C in small aliquots to minimize freeze-thaw cycles

Repeated freeze-thaw cycles should be avoided as they can lead to protein denaturation and loss of activity . For applications requiring buffer exchange, gentle methods such as dialysis or desalting columns are recommended to maintain protein integrity. The addition of reducing agents (DTT or β-mercaptoethanol) may be beneficial if the protein contains cysteine residues that could form disulfide bonds under oxidizing conditions.

What experimental designs are most effective for elucidating bll0647 function?

Several experimental designs are appropriate for investigating the function of bll0647, each addressing different aspects of protein characterization:

  • Gene Knockout Studies:

    • Generate a bll0647 deletion mutant in B. japonicum

    • Compare phenotypes between wild-type and mutant strains under various conditions

    • Perform complementation with recombinant bll0647 to confirm phenotype restoration

    • Independent variable: presence/absence of functional bll0647

    • Dependent variables: growth rates, stress tolerance, symbiotic efficiency

  • Protein-Protein Interaction Studies:

    • Employ pull-down assays using tagged bll0647 as bait

    • Perform yeast two-hybrid screening for potential interaction partners

    • Use chemical cross-linking followed by mass spectrometry

    • Independent variables: experimental conditions, potential binding partners

    • Dependent variables: binding affinities, interaction specificity

  • Metal Binding Characterization:

    • Conduct isothermal titration calorimetry with various metal ions

    • Implement differential scanning fluorimetry to assess thermal stability shifts

    • Perform site-directed mutagenesis of potential metal-coordinating residues

    • Independent variables: metal ion type, concentration, pH

    • Dependent variables: binding affinities, stoichiometry, specificity

These experimental designs should follow rigorous principles including proper control groups, randomization, and systematic manipulation of independent variables while monitoring dependent variables .

What hypothetical roles have been proposed for bll0647?

Several hypothetical functions have been proposed for UPF0314 protein bll0647 based on sequence homology and genomic context analysis:

  • Stress Response: UPF0314 proteins are often linked to stress response mechanisms in bacteria. This hypothesis is supported by genomic proximity to stress-response genes in the B. japonicum genome.

  • Metal Ion Binding: Sequence analysis suggests potential roles in binding divalent metal ions such as Ni²⁺ or Zn²⁺. The protein contains conserved residues commonly involved in metal coordination in other proteins.

  • Membrane-Associated Functions: The hydrophobic regions in the sequence suggest membrane localization, potentially involved in transport or signaling processes.

While direct functional data for bll0647 is limited, its genomic context implies auxiliary functions in host interaction. Further experimental validation through gene knockout studies, protein-protein interaction analysis, and phenotypic characterization would be necessary to definitively establish its biological role in B. japonicum.

How can researchers distinguish between direct and indirect effects in bll0647 functional studies?

Distinguishing between direct and indirect effects in bll0647 functional studies requires a systematic approach incorporating multiple controls and complementary methodologies:

  • Genetic Complementation Analysis:

    • Generate clean deletion mutants of bll0647

    • Complement with wild-type bll0647 expressed from a plasmid

    • Complement with point-mutated versions affecting specific domains

    • Use inducible promoters to titrate expression levels

    • Compare phenotypic restoration across constructs

  • Biochemical Validation:

    • Perform in vitro assays with purified recombinant protein

    • Validate direct binding to proposed substrates or partners

    • Use site-directed mutagenesis to disrupt specific interactions

    • Compare kinetic parameters of wild-type and mutant proteins

  • Time-Course Analysis:

    • Monitor changes in cellular responses with high temporal resolution

    • Direct effects typically manifest more rapidly than indirect ones

    • Use rapid induction/repression systems to control protein activity

  • Proximity-Based Approaches:

    • Employ techniques like BioID or APEX2 to identify proteins in close proximity

    • Use FRET-based sensors to monitor real-time interactions

    • Combine with subcellular fractionation to determine compartmentalization

Proper experimental design would include both positive controls (proteins with established functions similar to those hypothesized for bll0647) and negative controls (unrelated proteins of similar size/structure) to establish specificity .

How does bll0647 compare to homologous proteins in other bacteria?

Comparative analysis of bll0647 with homologous UPF0314 family proteins reveals insights into evolutionary and functional relationships:

  • Related Bacterial Proteins:

    • NolA in B. japonicum regulates nodulation processes

    • HypB controls nickel metabolism, essential for symbiotic enzymes

    • Other UPF0314 family members share structural features while serving diverse functions

  • Functional Implications from Homology:

    • Metal-binding domains suggest roles in metal homeostasis

    • Transmembrane regions indicate membrane localization

    • Conservation patterns highlight functionally important residues

  • Research Approach:

    • Sequence alignment to identify conserved motifs

    • Phylogenetic analysis to establish evolutionary relationships

    • Structure prediction and comparison across homologs

    • Heterologous complementation to test functional conservation

Researchers should employ multiple sequence alignment tools followed by conservation mapping onto predicted structural models to identify potential functional surfaces. Gene neighborhood analysis across different bacterial species can further illuminate functional associations and evolutionary patterns.

What relationship exists between bll0647 and symbiotic processes?

The relationship between bll0647 and symbiotic processes in Bradyrhizobium japonicum can be analyzed from multiple perspectives:

  • Genomic Context:

    • While bll0647 has no established direct role in symbiosis, its genomic proximity to stress-response genes implies auxiliary functions in host interaction

    • Related proteins such as NolA regulate nodulation processes in B. japonicum

  • Potential Functional Connections:

    • If involved in stress response, bll0647 may help bacteria adapt to plant microenvironment

    • Potential roles in metal transport could support metalloenzymes involved in nitrogen fixation

    • Membrane-associated functions might participate in signaling or nutrient exchange

  • Methodological Approaches:

    • Transcriptomic analysis during symbiotic stages

    • Nodulation assays comparing wild-type and bll0647 mutant strains

    • Protein localization studies during infection and nodule formation

    • Co-immunoprecipitation to identify symbiosis-related interaction partners

The potential metal-binding properties of bll0647 may indirectly support symbiotic functions requiring metal cofactors. To establish direct involvement, researchers should examine expression patterns during symbiotic stages and perform phenotypic analysis of mutant strains in plant association models.

How can ELISA applications utilizing bll0647 be optimized?

Optimizing ELISA applications with recombinant bll0647 requires careful consideration of several parameters:

  • Antigen Immobilization:

    • Determine optimal coating concentration (typically 1-10 μg/ml)

    • Compare direct adsorption versus oriented capture using affinity tags

    • Optimize coating buffer pH and ionic strength for maximum binding

    • Evaluate coating time and temperature (4°C overnight versus 37°C for shorter periods)

  • Assay Development:

    • Establish standard curves using purified antibodies or reference samples

    • Determine linear detection range and limit of detection

    • Optimize antibody concentrations through checkerboard titration

    • Select appropriate blocking agents to minimize background

  • Validation Parameters:

    • Assess intra- and inter-assay precision (CV typically <10% and <15% respectively)

    • Determine specificity through cross-reactivity testing with related proteins

    • Evaluate matrix effects using spike-recovery experiments

    • Confirm parallel dose-response curves between standards and samples

  • Technical Considerations:

    • The partially expressed region (amino acids 1-205) is sufficient for most immunoassay applications

    • Consider epitope accessibility when developing detection systems

    • Include positive and negative controls in each assay plate

    • Validate with alternative methods such as Western blotting

For quantitative applications, researchers should generate and characterize monoclonal antibodies with defined epitope specificity for improved reproducibility and specificity .

What computational methods can predict bll0647 interactions?

Advanced computational methods can generate valuable predictions about bll0647 interactions with other molecules:

  • Protein-Protein Interaction Prediction:

    • Sequence-based methods identify interaction motifs

    • Structure-based docking employs predicted 3D structures to model binding interfaces

    • Co-evolution analysis detects correlated mutations suggesting functional interactions

    • Machine learning approaches integrate multiple features for partner prediction

  • Protein-Metal Interaction Prediction:

    • Metal binding site prediction identifies potential coordination geometries

    • Quantum mechanical modeling calculates binding energies for different metal ions

    • Sequence motif analysis compares with established metal-binding patterns

  • Functional Association Networks:

    • Gene neighborhood analysis examines conserved genomic context

    • Co-expression data mining identifies genes with similar expression patterns

    • Phylogenetic profiling finds proteins with similar evolutionary patterns

  • Implementation Strategy:

    • Begin with multiple orthogonal prediction methods

    • Prioritize predictions based on convergence across methods

    • Design targeted experiments to validate high-confidence predictions

    • Iterate between computational predictions and experimental validation

These computational predictions should be treated as hypotheses requiring experimental validation. Integration of multiple prediction methods typically yields more reliable results than any single approach .

How do post-translational modifications affect bll0647 function?

The impact of post-translational modifications (PTMs) on bll0647 function represents an important research direction:

  • Potential Modifications:

    • Phosphorylation at serine/threonine/tyrosine residues may regulate activity

    • Metal ion coordination at histidine/cysteine residues could be essential for function

    • Lipid modifications might facilitate membrane association

    • Proteolytic processing could generate functionally distinct forms

  • Experimental Approaches:

    • Mass spectrometry to identify and map modifications

    • Site-directed mutagenesis of modified residues

    • Expression in systems with varying PTM capabilities

    • In vitro enzymatic modification followed by functional assays

  • Comparative Analysis:

    • Examine conservation of modifiable residues across homologs

    • Compare modifications in different growth conditions

    • Assess PTM patterns during symbiotic versus free-living states

  • Methodological Considerations:

    • Different expression systems provide varying post-translational modifications

    • E. coli offers limited modifications but higher yield

    • Insect and mammalian cells provide more sophisticated modifications but lower yield

    • Choose expression system based on which PTMs are essential for the specific research question

When designing experiments to study PTMs, researchers should consider using proximity labeling methods to identify modifying enzymes and targeted mass spectrometry for quantitative analysis of modification stoichiometry .

Could bll0647 function as an RNA-binding protein similar to other B. japonicum proteins?

The possibility that bll0647 might function as an RNA-binding protein warrants investigation, especially considering the recent characterization of other B. japonicum proteins with RNA-binding capabilities:

  • Precedent in B. japonicum:

    • HmuP in B. japonicum has been identified as an RNA-binding protein that regulates gene expression post-transcriptionally

    • HmuP binds to a specific RNA element (HPRE) within the 5'UTR of target genes

    • This binding suppresses a negative regulatory RNA element to enable gene expression

  • Sequence-Based Evidence:

    • Analysis of bll0647 sequence for RNA-binding motifs

    • Comparison with known bacterial RNA-binding proteins

    • Examination of charge distribution and structural features compatible with nucleic acid binding

  • Experimental Approaches:

    • RNA electrophoretic mobility shift assays (EMSA) with recombinant bll0647

    • SELEX (Systematic Evolution of Ligands by Exponential Enrichment) to identify potential RNA targets

    • RNA immunoprecipitation followed by sequencing (RIP-seq)

    • In vitro binding studies with potential target RNAs

  • Functional Validation:

    • Mutation of potential RNA-binding residues

    • Reporter assays with candidate target sequences

    • Assessment of gene expression changes in bll0647 mutants

This research direction would build upon the methodology used to characterize HmuP, where a combination of genetic approaches and in vitro binding studies established its role in post-transcriptional regulation .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.