Recombinant Bradyrhizobium sp. ATP synthase subunit a (atpB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please specify them when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have specific tag type requirements, please inform us, and we will prioritize the development of your specified tag.
Synonyms
atpB; BRADO6686; ATP synthase subunit a; ATP synthase F0 sector subunit a; F-ATPase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-247
Protein Length
full length protein
Species
Bradyrhizobium sp. (strain ORS 278)
Target Names
atpB
Target Protein Sequence
MIDPIEQFHLNKIFTIGHIGNQEIAFTTSSAYMLLAVVLIAAMMLGAGRALVPGRFQSVV ELAYEFVANTIRTSAGSHGMTFFPLVFSLFMFIFVSNIVGIIPYTFTVSSHIIVTFSLAL LVFLTVIIYGFYKNGLKFFKLFVPSGIPAVILPLVVIIEIISFFSRPISHSVRLFANMLA GHVTLKVFASFVTMLGALGFVGKVGALLPLGLTVALTGLELMVAFLQAYVFTILTCIYLN DAIHPGH
Uniprot No.

Target Background

Function
ATP synthase subunit a (atpB) is a key component of the proton channel, playing a direct role in the translocation of protons across the membrane.
Database Links
Protein Families
ATPase A chain family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the structure and function of ATP synthase subunit a in Bradyrhizobium?

ATP synthase subunit a in Bradyrhizobium is part of the membrane-embedded F0 region of ATP synthase, which is responsible for proton translocation across the bacterial membrane. This proton movement drives the conformational changes in the F1 region that catalyze ATP synthesis from ADP and inorganic phosphate.

Structurally, bacterial ATP synthases represent the simplest form of this enzyme complex, yet they perform the same core functions as their more complex mitochondrial counterparts. The architecture of the membrane region reveals that loops in subunit a of bacterial ATP synthase fulfill roles similar to additional specialized subunits present in mitochondrial enzymes . The subunit contributes to forming the proton channel and interacts with the rotating c-ring, creating the pathway for transmembrane proton translocation.

Unlike mitochondrial ATP synthases, bacterial versions like those in Bradyrhizobium have a structurally simpler and more flexible peripheral stalk, suggesting that the bacterial subunits a and the c-ring are primarily held together through hydrophobic interactions rather than being stabilized by the peripheral stalk .

How does the atpB gene differ from other ATP synthase components in Bradyrhizobium?

The atpB gene encodes the membrane-bound subunit a of the F0 portion of ATP synthase in Bradyrhizobium species. Unlike other ATP synthase components that may be involved in the catalytic mechanism or structural stability, subunit a specifically participates in proton translocation through the membrane.

While components of the F1 region (such as the α, β, and γ subunits) show high sequence conservation across species, the membrane-embedded subunits like a (encoded by atpB) typically display greater sequence variability, reflecting adaptation to specific membrane environments and energetic requirements of different bacterial species.

In the context of Bradyrhizobium, which can grow on different carbon sources such as D-mannitol or L-arabinose , the expression and regulation of atpB may be influenced by the metabolic state of the cell. The protein-protein interaction (PPI) networks identified in Bradyrhizobium diazoefficiens suggest that ATP synthase components, including subunit a, may interact differently depending on whether the bacterium is in a free-living state or a symbiotic nitrogen-fixing state .

What expression systems are most suitable for producing recombinant Bradyrhizobium ATP synthase subunit a?

Based on successful studies with other bacterial ATP synthases, Escherichia coli represents a viable expression system for recombinant Bradyrhizobium ATP synthase subunit a. Researchers have successfully expressed the Bacillus PS3 ATP synthase in E. coli, purified it, and obtained high-resolution structural information through cryo-EM analysis .

For optimal expression of Bradyrhizobium atpB, researchers should consider the following approaches:

Expression SystemAdvantagesDisadvantagesOptimization Strategies
E. coli BL21(DE3)Widely used, high yield potentialMay mishandle membrane proteinsUse lower temperatures, specialized media
E. coli C41/C43 strainsDesigned for toxic membrane proteinsLower yield than standard strainsOptimize induction conditions
Cell-free expressionAvoids toxicity issuesHigher cost, technical complexityAdd lipids or detergents during synthesis
Homologous expressionNatural folding environmentSlow growth rate of BradyrhizobiumUse strong promoters, optimize conditions

Codon optimization for E. coli expression, addition of solubility or purification tags, and careful selection of detergents for membrane protein extraction are additional strategies that can improve yield and functionality of the recombinant protein.

How do researchers distinguish between functional and non-functional recombinant ATP synthase subunit a?

Distinguishing between functional and non-functional recombinant ATP synthase subunit a requires multiple complementary approaches:

  • Structural integrity assessment: Proper folding can be evaluated using circular dichroism spectroscopy to analyze secondary structure content, and thermal stability assays to assess protein stability.

  • Membrane insertion analysis: Techniques such as protease protection assays and fluorescence-based membrane association studies can verify correct membrane topology.

  • Functional reconstitution: The gold standard for functionality involves reconstituting the recombinant subunit a with other ATP synthase components and measuring ATP synthesis activity. This approach has been successfully used with bacterial ATP synthases like the one from Bacillus PS3 .

  • Proton translocation assays: Using pH-sensitive fluorescent probes, researchers can directly assess the ability of reconstituted ATP synthase containing the recombinant subunit a to translocate protons across membranes.

  • Protein-protein interaction studies: Co-immunoprecipitation, crosslinking assays, or computational approaches similar to those used for studying the interactome of Bradyrhizobium diazoefficiens can verify proper interactions with other ATP synthase subunits .

A combination of these approaches provides comprehensive evidence of functionality, as no single assay can definitively establish that the recombinant protein is fully functional in all aspects.

What are the critical residues in ATP synthase subunit a that affect proton translocation efficiency?

The proton translocation pathway in ATP synthase subunit a contains several critical residues that have been identified through decades of biochemical and structural studies. While specific data for Bradyrhizobium is limited, insights from other bacterial ATP synthases provide valuable guidance.

Key residues typically include:

  • Conserved arginine residue: A highly conserved arginine in subunit a is critical for proton translocation, acting as a gate that facilitates proton movement between the periplasm and the c-ring.

  • Acidic residues: Negatively charged residues (aspartate and glutamate) often create a pathway for proton movement through the membrane portion.

  • Polar residues: Strategically positioned polar amino acids can form hydrogen bonds with water molecules, facilitating proton transfer along the channel.

The high-resolution structures of bacterial ATP synthases reveal the path of transmembrane proton translocation and provide a framework for understanding how specific residues contribute to this process . Researchers studying Bradyrhizobium atpB can use comparative sequence analysis and structural modeling to identify these critical residues in the Bradyrhizobium sequence and design targeted mutagenesis experiments to verify their functional importance.

How does the ATP synthase subunit a contribute to energy conservation during symbiotic nitrogen fixation?

During symbiotic nitrogen fixation, Bradyrhizobium undergoes significant metabolic adaptations to accommodate the energy-intensive process of converting atmospheric nitrogen to ammonia. ATP synthase subunit a plays a crucial role in energy conservation during this process through several mechanisms:

Integrated analysis of transcriptome and proteome data, as performed for Bradyrhizobium diazoefficiens, allows researchers to identify how ATP synthase components, including subunit a, function within the broader metabolic network during symbiotic nitrogen fixation .

What purification strategies yield the highest purity and stability of recombinant ATP synthase subunit a?

Purifying membrane proteins like ATP synthase subunit a presents significant challenges due to their hydrophobic nature. Based on successful approaches with other bacterial ATP synthases, the following purification strategies are recommended:

Purification StepMethodCritical ParametersConsiderations
Membrane extractionDifferential centrifugationBuffer composition, centrifugation speedPreserve native lipid interactions
SolubilizationDetergent treatmentDetergent type, concentration, timeSelect mild detergents (DDM, LMNG)
Affinity purificationHis-tag or other fusion tagsImidazole concentration, wash conditionsMinimize exposure to high imidazole
Size exclusionGel filtration chromatographyFlow rate, buffer compositionRemove aggregates and detergent micelles
ReconstitutionProteoliposome formationLipid composition, protein:lipid ratioEssential for functional studies

The successful purification of intact bacterial ATP synthase from Bacillus PS3 expressed in E. coli demonstrates that with appropriate optimization, recombinant ATP synthase components can be isolated in a functional state. For Bradyrhizobium ATP synthase subunit a, maintaining the protein in a lipid-like environment throughout purification is critical for stability and function.

Researchers should monitor protein quality at each step using techniques such as SDS-PAGE, Western blotting, and negative-stain electron microscopy to ensure structural integrity before proceeding to functional assays or structural studies.

How can researchers optimize codon usage for heterologous expression of Bradyrhizobium atpB?

Optimizing codon usage is essential for efficient expression of Bradyrhizobium genes in heterologous hosts due to differences in codon preference between species. The following methodology is recommended:

This approach has proven successful for expressing membrane proteins from diverse bacterial sources, including ATP synthase components. Researchers should note that excessive optimization can sometimes lead to protein misfolding due to altered translation kinetics, so empirical testing remains essential.

What methods are most effective for assessing the interaction between recombinant ATP synthase subunit a and other ATP synthase components?

Understanding the interactions between ATP synthase subunit a and other components is crucial for elucidating the assembly and function of the complete complex. Several complementary methods are recommended:

  • Co-immunoprecipitation (Co-IP): This technique can identify direct protein-protein interactions between subunit a and other ATP synthase components. Tagged versions of recombinant subunit a can be used to pull down interacting partners.

  • Crosslinking coupled with mass spectrometry: Chemical crosslinking followed by mass spectrometric analysis can identify interaction interfaces with residue-level precision, providing detailed information about the structural arrangement of the complex.

  • Förster resonance energy transfer (FRET): By labeling subunit a and potential interacting partners with appropriate fluorophores, researchers can detect and quantify interactions in reconstituted systems.

  • Computational prediction methods: Approaches similar to the "Interolog" and domain-based methods used to reconstruct the protein interactome of Bradyrhizobium diazoefficiens can predict potential interaction partners of subunit a.

  • Cryo-electron microscopy (cryo-EM): This technique has been successfully used to determine the structure of intact ATP synthase from Bacillus PS3 , revealing the positions and interactions of individual subunits, including subunit a.

The integration of experimental data from these approaches with computational models provides a comprehensive understanding of how subunit a interacts with other components within the ATP synthase complex.

How do mutations in conserved residues of atpB affect ATP synthase assembly and function?

Mutations in conserved residues of ATP synthase subunit a can have profound effects on both assembly and function of the complex. Analysis of such mutations requires a systematic approach:

  • Identification of conserved residues: Comparative sequence analysis across bacterial species can identify highly conserved amino acids in subunit a, which likely play critical structural or functional roles.

  • Site-directed mutagenesis: Strategic substitutions (conservative and non-conservative) can be introduced at these positions to test their importance.

  • Assembly analysis: Techniques such as blue native PAGE, size exclusion chromatography, and electron microscopy can assess whether mutations affect the assembly of the complete ATP synthase complex.

  • Functional assessment: ATP synthesis activity, proton translocation, and ATP hydrolysis measurements can determine how specific mutations affect each aspect of ATP synthase function.

Studies on bacterial ATP synthases have revealed several classes of mutations in subunit a:

Mutation TypeAssembly EffectFunctional EffectMechanistic Insight
Proton path residuesOften minimalSevere impairmentDirectly affects proton translocation
Interface residuesModerate to severeVariableDisrupts interaction with c-ring or other subunits
Structural residuesSevereComplete lossPrevents proper folding or membrane insertion

Analysis of mutations should consider both direct effects on catalysis and indirect effects on protein stability or complex assembly. The structures of bacterial ATP synthase in different rotational states provide a framework for interpreting how specific mutations might disrupt the coordinated movements necessary for ATP synthesis.

What approaches can resolve contradictory data about ATP synthase function in Bradyrhizobium?

Resolving contradictory data about ATP synthase function in Bradyrhizobium requires systematic analysis and multiple lines of evidence. Researchers should implement the following strategies:

  • Standardize experimental conditions: Different growth conditions, carbon sources, and oxygen levels significantly affect Bradyrhizobium metabolism , potentially leading to contradictory results when conditions vary between studies.

  • Consider physiological state: Free-living cells versus symbiotic bacteroids show distinct metabolic patterns . Contradictory data may result from studying ATP synthase in different physiological contexts.

  • Integrate multi-omics approaches: Combining transcriptomics, proteomics, and metabolomics data, as demonstrated for studying protein interaction networks in Bradyrhizobium diazoefficiens , can provide a comprehensive understanding that resolves apparent contradictions.

  • Examine strain-specific differences: Genetic variations between Bradyrhizobium strains may lead to functional differences in ATP synthase activity or regulation.

  • Use isogenic mutants: Creating defined mutations in the same genetic background eliminates variables that might cause contradictory results between studies.

  • Apply complementary techniques: Different assay methods may measure distinct aspects of ATP synthase function, leading to seemingly contradictory results that actually reflect different facets of the same complex process.

This systematic approach allows researchers to determine whether contradictions represent actual biological variability or result from methodological differences, providing a more complete understanding of ATP synthase function in Bradyrhizobium.

How can researchers distinguish between direct and indirect effects when studying atpB mutants?

Distinguishing between direct and indirect effects of atpB mutations requires careful experimental design and multiple control experiments:

  • Complementation studies: Reintroducing wild-type atpB or site-directed mutants into a null background can confirm whether phenotypes are directly attributable to the absence or mutation of subunit a.

  • Suppressor mutation analysis: Secondary mutations that restore function can reveal functional relationships and distinguish primary from secondary effects.

  • Temporal analysis: Monitoring changes immediately following induction of mutations versus long-term adaptations can separate direct consequences from compensatory responses.

  • Metabolic profiling: Comprehensive analysis of metabolic pathways can reveal whether phenotypes result directly from ATP synthesis defects or from downstream metabolic adaptations.

  • Protein-protein interaction studies: Changes in the interaction network of ATP synthase components following atpB mutation can help identify direct structural effects versus secondary signaling consequences.

  • In vitro reconstitution: Isolating the effects of mutations in a defined, reconstituted system eliminates cellular complexities that might introduce indirect effects.

This multi-faceted approach is particularly important when studying ATP synthase in Bradyrhizobium, where complex metabolic networks and adaptations to different carbon sources or growth conditions can complicate interpretation of mutant phenotypes.

How might structural biology techniques advance our understanding of Bradyrhizobium ATP synthase?

Advanced structural biology techniques offer tremendous potential for elucidating the unique features of Bradyrhizobium ATP synthase:

  • Cryo-electron microscopy (cryo-EM): This technique has revolutionized membrane protein structural biology, allowing visualization of intact ATP synthase complexes in different rotational states, as demonstrated for Bacillus PS3 ATP synthase . For Bradyrhizobium, cryo-EM could reveal unique structural adaptations related to its symbiotic lifestyle.

  • Integrative structural biology: Combining cryo-EM with other techniques such as X-ray crystallography, NMR spectroscopy, and computational modeling would provide a comprehensive structural understanding across multiple scales.

  • Time-resolved structural methods: Capturing structural changes during the catalytic cycle could illuminate how Bradyrhizobium ATP synthase couples proton translocation to ATP synthesis under varying environmental conditions.

  • In situ structural studies: Techniques like cryo-electron tomography could visualize ATP synthase in its native membrane environment, potentially revealing associations with other respiratory complexes specific to Bradyrhizobium.

  • Structure-guided functional studies: High-resolution structures would enable precise mutagenesis of specific residues predicted to be involved in proton translocation or subunit interactions, allowing direct testing of mechanistic hypotheses.

These approaches would bridge current knowledge gaps, particularly regarding how ATP synthase structure and function may be adapted for efficient energy conservation during symbiotic nitrogen fixation.

What role might ATP synthase play in the adaptation of Bradyrhizobium to different environmental niches?

ATP synthase likely plays a central role in Bradyrhizobium adaptation to diverse environmental conditions through several mechanisms:

  • Metabolic flexibility: Bradyrhizobium can utilize different carbon sources such as D-mannitol and L-arabinose , requiring adjustments in energy metabolism. ATP synthase activity may be modulated to accommodate varying ATP demands and proton motive force generation under different nutritional conditions.

  • Oxygen response: Bradyrhizobium exhibits different oxygen consumption rates depending on carbon source , suggesting respiratory chain adjustments that would affect ATP synthase operation.

  • Symbiotic adaptation: During the transition from free-living to symbiotic states, Bradyrhizobium undergoes substantial metabolic reprogramming. The protein interaction networks differ between these states , potentially involving changes in ATP synthase regulation or assembly.

  • Stress resistance: ATP synthase may contribute to pH homeostasis and membrane potential maintenance during environmental stress, supporting survival in acidic soils or during osmotic challenges.

  • Energy conservation during nutrient limitation: Fine-tuning of ATP synthase activity could optimize energy use when resources are scarce, contributing to the ecological success of Bradyrhizobium in nutrient-poor environments.

Future research could explore how ATP synthase subunit composition, post-translational modifications, or regulatory interactions change across environmental conditions, providing insights into Bradyrhizobium adaptation strategies.

How might synthetic biology approaches utilize engineered Bradyrhizobium ATP synthase variants?

Synthetic biology approaches offer exciting possibilities for engineering Bradyrhizobium ATP synthase for both research and biotechnological applications:

  • Enhanced symbiotic efficiency: Engineering ATP synthase variants with optimized energy conversion efficiency could improve nitrogen fixation rates in agricultural settings, reducing the need for chemical fertilizers.

  • Biosensor development: Modified ATP synthase variants could serve as sensitive biosensors for environmental parameters relevant to soil health or agricultural productivity.

  • Minimal ATP synthase design: Creating simplified versions of Bradyrhizobium ATP synthase could reveal the core structural and functional requirements of the enzyme, advancing fundamental knowledge.

  • Cross-species chimeric complexes: Exchanging domains between Bradyrhizobium and other bacterial ATP synthases could identify species-specific adaptations and potentially create enzymes with novel properties.

  • Optogenetic control: Incorporating light-sensitive domains could enable precise spatiotemporal control of ATP synthase activity for research purposes.

  • Bioelectrochemical applications: Engineered ATP synthase variants could serve as components in bioelectrochemical systems, converting electrical energy into biological energy carriers.

These approaches would not only advance our fundamental understanding of ATP synthase biology but could also contribute to sustainable agriculture through improved plant-microbe interactions and novel biotechnological applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.