Recombinant Bradyrhizobium sp. ATP synthase subunit b' (atpG)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months under the same conditions.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If a specific tag type is required, please inform us; we will prioritize its development.
Synonyms
atpF2; atpG; BBta_0844; ATP synthase subunit b 2; ATP synthase F(0 sector subunit b 2; ATPase subunit I 2; F-type ATPase subunit b 2; F-ATPase subunit b 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-186
Protein Length
full length protein
Species
Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182)
Target Names
atpF2
Target Protein Sequence
MAESHGEAKGTASAHTEAEGGHGFPPFQKETFPSQIVSLVITFVALYVIVSRLALPKVGG VIDARQKAIDGDLAEAQRLNDESEAAMKAYESELAAARARAQAIGAETREKLAASSDAER KALEDSLAAKLAAAEKSIATTRATAMSNVRGIAADAASAIVQQLTGKAPAGKTVEAAVDA SLKGTA
Uniprot No.

Target Background

Function
F1F0 ATP synthase synthesizes ATP from ADP using a proton or sodium gradient. This enzyme comprises two domains: the F1 domain, containing the extramembrane catalytic core, and the F0 domain, housing the membrane proton channel. These domains are linked by a central and a peripheral stalk. ATP synthesis within the F1 catalytic domain is coupled, via a rotary mechanism involving the central stalk subunits, to proton translocation. The b' subunit, a divergent and duplicated form of the b subunit found in plants and photosynthetic bacteria, is a component of the F0 channel and forms part of the peripheral stalk, linking F1 and F0.
Database Links
Protein Families
ATPase B chain family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

Structural Characteristics

Q: What is the basic structure of ATP synthase subunit b' (atpG) in Bradyrhizobium sp.?

A: ATP synthase subunit b' (atpG) in Bradyrhizobium sp. is part of the F₀F₁-ATP synthase complex, which is responsible for ATP production during oxidative phosphorylation. Similar to what has been observed in other bacterial species, the b subunit exists as a dimer within the ATP synthase complex, with residues 62-122 being crucial for mediating this dimerization . The crystal structure studies of the b subunit dimerization domain at 1.55 Å resolution reveal that it forms an extremely elongated structure, with a frictional ratio of 1.60, a maximal dimension of 95 Å, and a radius of gyration of 27 Å. These parameters are consistent with an alpha-helical coiled-coil structure . In its crystallized form, the protein presents as an isolated, monomeric alpha helix with a length of approximately 90 Å .

Q: How does the amino acid sequence of Bradyrhizobium sp. atpG compare to other bacterial species?

A: While there isn't specific sequence comparison data for Bradyrhizobium sp. atpG in the provided search results, we can draw insights from related species. For instance, in Oligotropha carboxidovorans, the ATP synthase subunit b/b' (atpG) protein consists of 187 amino acids . Sequence homology studies generally show conservation of key functional domains across different bacterial species, particularly in regions responsible for dimerization and interaction with other ATP synthase subunits. The specific amino acid sequence would need to be analyzed using bioinformatics tools to determine exact homology percentages with other bacterial atpG proteins. For accurate sequence analysis, researchers should perform alignment studies using tools like BLAST or Clustal Omega with the Bradyrhizobium sp. atpG sequence against known sequences from related species.

Expression and Purification

Q: What expression systems are most effective for producing recombinant Bradyrhizobium sp. atpG protein?

A: Based on related recombinant protein production methods, E. coli expression systems are commonly used for bacterial ATP synthase subunits. For instance, recombinant ATP synthase subunit b/b' from Oligotropha carboxidovorans was successfully expressed in E. coli with an N-terminal His tag . For Bradyrhizobium sp. atpG, a similar approach would likely be effective. The methodology would typically involve:

  • Gene cloning into an appropriate expression vector

  • Transformation into an E. coli expression strain (BL21(DE3) or similar)

  • Induction using IPTG (isopropyl β-D-1-thiogalactopyranoside)

  • Optimization of growth conditions (temperature, medium composition, induction time)

Q: What purification strategies yield the highest purity for recombinant atpG protein?

A: For high-purity recombinant atpG protein, a multi-step purification strategy is recommended. Based on established protocols for similar proteins, the following approach would be effective:

  • Affinity chromatography: Using a His-tag system as demonstrated with the Oligotropha carboxidovorans ATP synthase subunit b/b' , where purity greater than 90% was achieved as determined by SDS-PAGE.

  • Additional purification steps may include:

    • Ion exchange chromatography

    • Size exclusion chromatography

    • Hydrophobic interaction chromatography

For optimal results, cell lysis conditions should be optimized to ensure efficient protein extraction while maintaining protein stability. Buffer composition during purification steps is critical, typically containing components that maintain protein stability (e.g., appropriate pH, salt concentration, and possibly glycerol or reducing agents). Quality control should include SDS-PAGE analysis and activity assays to confirm both purity and functional integrity of the purified protein.

Functional Analysis and Characterization

Q: How can I assess the functional integrity of recombinant Bradyrhizobium sp. atpG protein?

A: To assess functional integrity of recombinant Bradyrhizobium sp. atpG protein, researchers should employ multiple complementary approaches:

  • Dimerization assays: Since the b subunit functions as a dimer in ATP synthase , analytical techniques to assess dimerization include:

    • Analytical ultracentrifugation

    • Solution small-angle X-ray scattering (SAXS)

    • Size exclusion chromatography coupled with multi-angle light scattering (SEC-MALS)

  • Structural analysis:

    • Circular dichroism spectroscopy to verify alpha-helical content consistent with the expected coiled-coil structure

    • Limited proteolysis to assess proper folding

    • Thermal shift assays to determine protein stability

  • Binding assays:

    • Interaction studies with other ATP synthase subunits

    • Surface plasmon resonance or isothermal titration calorimetry to quantify binding affinities

  • Reconstitution studies:

    • Assembly with other ATP synthase components to assess proper incorporation into the complex

    • Functional reconstitution into liposomes to measure ATP synthesis activity

These methods collectively provide a comprehensive assessment of whether the recombinant protein maintains native-like structure and functional properties.

Q: What role does atpG play in ATP synthesis in Bradyrhizobium sp., and how can this be studied experimentally?

A: The atpG subunit in ATP synthase serves crucial structural and functional roles that can be experimentally investigated:

  • Structural role: The b subunit forms part of the peripheral stalk of ATP synthase, connecting the F₁ and F₀ domains and preventing unproductive rotation of F₁ . This structural role can be studied through:

    • Cryo-electron microscopy of the assembled ATP synthase complex

    • Cross-linking studies to map interactions with other subunits

    • Mutational analysis of key residues in the dimerization domain (residues 62-122)

  • Functional studies:

    • ATP synthesis assays using reconstituted systems with wild-type or mutant atpG

    • Proton translocation measurements

    • ATP hydrolysis assays to assess the enzyme's reverse activity

  • Comparative analysis:

    • Creating Bradyrhizobium sp. atpG deletion mutants and complementation strains

    • Measuring growth rates and ATP levels in these strains

    • Comparing membrane potential and proton gradient maintenance

These experimental approaches would provide insights into both the structural contribution of atpG to the ATP synthase complex stability and its functional importance in energy conservation in Bradyrhizobium sp.

Role in Symbiotic Interactions

Q: How does atpG expression change during symbiosis establishment in Bradyrhizobium sp., and what techniques can detect these changes?

A: To investigate atpG expression changes during symbiosis establishment in Bradyrhizobium sp., researchers can employ the following approaches:

  • Transcriptional analysis:

    • RNA-seq to measure global transcriptional changes, including atpG, during different stages of symbiosis

    • Quantitative RT-PCR for targeted measurement of atpG transcript levels

    • Reporter gene fusions (e.g., atpG promoter-GFP) to visualize expression patterns in planta

  • Protein-level analysis:

    • Proteomics approaches similar to those used to study protein production changes in Bradyrhizobium diazoefficiens under different carbon sources

    • Western blotting with atpG-specific antibodies

    • Immunocytochemistry to localize the protein within bacteroids

  • Metabolic activity correlation:

    • Measurements of ATP levels in bacteroids at different developmental stages

    • Oxygen consumption rates, which have been shown to vary significantly in Bradyrhizobium under different metabolic conditions

When designing these experiments, researchers should consider that symbiotic conditions might induce significant metabolic reprogramming in Bradyrhizobium, as evidenced by the differential protein production observed under different carbon sources . The methodological approach should include appropriate controls and time points to capture the dynamic nature of the symbiotic process.

Q: What is the relationship between ATP synthase function and nodulation efficiency in Bradyrhizobium sp.?

A: The relationship between ATP synthase function and nodulation efficiency in Bradyrhizobium sp. can be investigated through several methodological approaches:

  • Mutational analysis:

    • Generate specific mutations in atpG or other ATP synthase subunits

    • Compare nodulation efficiency (number, size, timing) of mutants versus wild-type

    • Assess nitrogenase activity in nodules formed by these strains using acetylene reduction assays

  • Energy status assessment:

    • Measure ATP/ADP ratios in wild-type and ATP synthase-compromised strains during nodulation

    • Correlate energy status with nodulation markers and stages

  • Comparative studies with other symbiotic systems:

    • Similar to studies on ΔcopG₁ and ΔcopG₂ mutants which showed differential effects on nodulation in Bradyrhizobium sp. SUTN9-2

    • Assess symbiotic phenotypes in different host plants to determine host-specificity effects

  • Integration with other regulatory systems:

    • Investigate potential interactions between ATP synthase function and known symbiosis regulators

    • For example, in Bradyrhizobium sp. SUTN9-2, copG₁ acts as a repressor of Type IV secretion system genes and is required for nod gene expression

This methodological framework would help establish causative relationships between ATP synthase function, energy metabolism, and symbiotic efficiency in Bradyrhizobium sp.

Structure-Function Relationships

Q: How do mutations in critical regions of atpG affect ATP synthase assembly and function in Bradyrhizobium sp.?

A: To investigate the impact of mutations in critical regions of atpG on ATP synthase assembly and function in Bradyrhizobium sp., the following experimental approach is recommended:

  • Targeted mutagenesis:

    • Create a series of mutations focusing on the dimerization domain (residues 62-122)

    • Include both conservative and non-conservative substitutions

    • Generate truncation mutants to assess domain contributions

  • Assembly assessment:

    • Blue Native PAGE to analyze intact ATP synthase complex formation

    • Co-immunoprecipitation studies to evaluate interactions with other subunits

    • Analytical ultracentrifugation to determine oligomeric state changes

  • Functional characterization:

    • ATP synthesis/hydrolysis assays with reconstituted mutant complexes

    • Proton translocation measurements

    • Membrane potential assessments

  • In vivo phenotypic analysis:

    • Growth characteristics under different energy sources

    • Cell morphology and membrane integrity

    • Symbiotic phenotypes if expressed in Bradyrhizobium sp.

The interpretation of results should consider that the b subunit's 90 Å alpha-helical structure likely serves as a critical structural component in maintaining the spatial relationship between F₁ and F₀ domains of ATP synthase. Mutations disrupting this function would have cascading effects on energy conservation and cellular metabolism.

Q: What techniques can be used to study the interaction between atpG and other subunits of the ATP synthase complex?

A: Several complementary techniques can be employed to study interactions between atpG and other ATP synthase subunits:

  • Protein-protein interaction analysis:

    • Yeast two-hybrid or bacterial two-hybrid assays for pairwise interaction mapping

    • Pull-down assays using tagged atpG to identify binding partners

    • Surface plasmon resonance (SPR) or bio-layer interferometry (BLI) for kinetic and affinity measurements

  • Structural approaches:

    • Cross-linking coupled with mass spectrometry (XL-MS) to identify interaction interfaces

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to map binding surfaces

    • Cryo-electron microscopy of the assembled complex

    • X-ray crystallography of sub-complexes

  • Computational methods:

    • Molecular dynamics simulations to predict stable interaction conformations

    • Protein-protein docking

    • Evolutionary coupling analysis to identify co-evolving residues

  • Functional validation:

    • Mutagenesis of predicted interface residues followed by interaction studies

    • Complementation assays with chimeric proteins

    • FRET-based approaches to study interactions in living cells

Overcoming Technical Challenges

Q: What are the main technical challenges in expressing and purifying Bradyrhizobium sp. atpG, and how can they be addressed?

A: Expression and purification of Bradyrhizobium sp. atpG presents several technical challenges that can be methodically addressed:

  • Protein solubility issues:

    • Challenge: atpG may form inclusion bodies when overexpressed

    • Solution: Optimize expression conditions (lower temperature, reduced inducer concentration)

    • Alternative approach: Use solubility-enhancing fusion partners (MBP, SUMO, TrxA)

    • Methodology: Compare protein yields across multiple expression conditions using small-scale test expressions

  • Structural integrity maintenance:

    • Challenge: Preserving the native alpha-helical structure during purification

    • Solution: Include stabilizing agents in buffers (glycerol, specific salt concentrations)

    • Methodology: Monitor secondary structure by circular dichroism throughout purification process

  • Dimerization preservation:

    • Challenge: Maintaining proper oligomeric state, as the b subunit functions as a dimer

    • Solution: Optimize buffer conditions to promote dimerization

    • Methodology: Assess oligomeric state using analytical ultracentrifugation or size exclusion chromatography coupled with multi-angle light scattering

  • Membrane protein handling:

    • Challenge: If atpG has membrane-associated regions, extraction may be difficult

    • Solution: Screen detergents for optimal extraction and stability

    • Methodology: Systematic detergent screening followed by stability and functional assays

  • Yield optimization:

    • Challenge: Achieving sufficient yield for structural and functional studies

    • Solution: Scale-up strategies, including bioreactor cultivation

    • Methodology: Process development focusing on optimizing cell density and induction parameters

The purification strategy should be developed with these challenges in mind, aiming for greater than 90% purity as achieved with similar proteins , while maintaining functional integrity throughout the process.

Q: How can I develop a reliable activity assay for recombinant atpG protein?

A: Developing a reliable activity assay for recombinant atpG protein requires consideration of its role within the ATP synthase complex:

  • Direct functional assays:

    • Reconstitution approach: Incorporate purified atpG into ATP synthase complex lacking endogenous b subunit

    • Measurement parameters: ATP synthesis rate, proton translocation efficiency

    • Controls: Comparison with native complex and negative controls (denatured protein)

  • Binding assays as proxy for function:

    • Principle: Proper function requires correct interaction with other ATP synthase subunits

    • Methodology: Surface plasmon resonance or isothermal titration calorimetry to quantify binding to partner subunits

    • Validation: Competition assays with native protein

  • Structural integrity assessments:

    • Circular dichroism to confirm alpha-helical content consistent with functional conformation

    • Thermal shift assays to measure stability under various conditions

    • Limited proteolysis to assess proper folding

  • Dimerization assays:

    • Analytical ultracentrifugation or small-angle X-ray scattering to verify proper dimer formation

    • Chemical cross-linking followed by SDS-PAGE or mass spectrometry

A comprehensive activity assay would ideally combine elements of these approaches, establishing a correlation between structural parameters (dimerization, alpha-helical content) and functional outcomes (subunit binding, ATP synthesis support) to provide a robust assessment of recombinant atpG activity.

Data Analysis and Interpretation

Q: How should I interpret differences in atpG expression under various environmental conditions in Bradyrhizobium sp.?

A: When interpreting differences in atpG expression under various environmental conditions in Bradyrhizobium sp., consider the following methodological framework:

  • Establish a robust baseline:

    • Define "standard" growth conditions as your reference point

    • Ensure technical and biological replicates are included

    • Normalize expression data to validated reference genes that maintain stable expression across conditions

  • Statistical analysis approach:

    • Apply appropriate statistical tests (ANOVA with post-hoc tests for multiple comparisons)

    • Calculate fold changes with confidence intervals

    • Consider using statistical packages designed for gene expression analysis

  • Contextual interpretation:

    • Compare atpG expression changes with other ATP synthase subunits to determine if regulation is coordinated

    • Correlate expression changes with physiological parameters (growth rate, ATP levels, oxygen consumption)

    • Consider that Bradyrhizobium sp. undergoes significant metabolic reprogramming under different carbon sources , which may affect energy metabolism genes

  • Validation strategies:

    • Confirm transcriptional changes with protein-level measurements

    • Perform targeted metabolomics to assess impact on energy metabolites

    • Consider flux analysis to determine functional consequences

  • Integration with existing knowledge:

    • Compare findings with known regulatory patterns in related bacteria

    • Consider potential regulatory mechanisms (e.g., similar to how copG₁ regulates various genes in Bradyrhizobium sp. )

This structured approach will help distinguish biologically significant changes from experimental variation and place atpG expression differences within the broader context of Bradyrhizobium sp. physiology and adaptation.

Q: What statistical approaches are most appropriate for analyzing atpG mutation effects on ATP synthase function?

A: When analyzing the effects of atpG mutations on ATP synthase function, the following statistical approaches are recommended:

  • For comparing multiple mutants to wild-type:

    • One-way ANOVA followed by appropriate post-hoc tests (e.g., Dunnett's test for comparing multiple treatments to a control)

    • Control for multiple comparisons using methods such as Bonferroni correction or false discovery rate

    • Calculate effect sizes (Cohen's d) to quantify the magnitude of differences

  • For dose-response relationships:

    • Regression analysis to establish relationship between mutation severity and functional impact

    • Nonlinear regression for parameters that may show threshold effects

    • Statistical tests for goodness of fit to determine appropriate models

  • For correlation analyses:

    • Pearson or Spearman correlation to assess relationships between structural parameters and functional outcomes

    • Principal component analysis for datasets with multiple measured parameters

    • Hierarchical clustering to identify mutations with similar functional profiles

  • For time-course experiments:

    • Repeated measures ANOVA or mixed-effects models

    • Time series analysis for dynamic behaviors

    • Area under the curve calculations for cumulative effects

  • Experimental design considerations:

    • Power analysis to determine appropriate sample sizes

    • Randomization and blinding procedures to minimize bias

    • Inclusion of appropriate positive and negative controls

These statistical approaches should be applied within the context of well-designed experiments that include adequate replication and control for confounding variables. The analysis should aim to distinguish between mutations that affect assembly, stability, subunit interactions, or catalytic function of the ATP synthase complex.

Biotechnological Applications

Q: How can engineered variants of Bradyrhizobium sp. atpG be used to improve bacterial symbiosis with legumes?

A: Engineered variants of Bradyrhizobium sp. atpG could potentially enhance symbiotic interactions with legumes through several methodological approaches:

  • Energy efficiency optimization:

    • Create atpG variants with enhanced ATP synthesis efficiency

    • Methodology: Site-directed mutagenesis targeting residues at subunit interfaces

    • Expected outcome: Improved energy metabolism supporting nodulation processes

    • Assessment: Compare nodulation efficiency, nitrogenase activity, and plant growth promotion

  • Environmental adaptation enhancement:

    • Engineer atpG variants with improved stability under stress conditions

    • Target conditions relevant to agricultural settings (temperature fluctuations, soil acidity)

    • Methodology: Directed evolution under selective pressure

    • Validation: Field trials under varying environmental conditions

  • Host-range expansion:

    • Integration of atpG modifications with other symbiotic determinants

    • Similar to studies on regulatory proteins like copG₁ that affect nodulation in specific hosts

    • Methodology: Create chimeric proteins combining domains from different Bradyrhizobium species

    • Assessment: Test symbiotic capacity with non-traditional host plants

  • Coordination with symbiotic signaling:

    • Engineer regulatory connections between atpG expression and symbiotic signaling pathways

    • Methodology: Create synthetic promoters responsive to plant signals

    • Expected outcome: Better temporal coordination of energy production with symbiotic demands

These approaches would require careful genetic engineering, extensive phenotypic characterization, and ultimately field testing to validate improvements in symbiotic performance under agricultural conditions.

Q: What potential biotechnological applications exist for recombinant Bradyrhizobium sp. atpG beyond symbiosis studies?

A: Recombinant Bradyrhizobium sp. atpG has several potential biotechnological applications beyond symbiosis studies:

  • Structural biology platform:

    • The alpha-helical coiled-coil structure of atpG makes it valuable as a scaffold for protein engineering

    • Applications: Design of novel protein architectures, nanomaterials, or biosensors

    • Methodological approach: Fusion of functional domains to stable atpG scaffolds

  • Bioenergetic systems engineering:

    • Incorporation of modified atpG into synthetic ATP-generating systems

    • Target applications: Biofuel cells, ATP-regenerating systems for cell-free protein synthesis

    • Methodology: Reconstitution of designer ATP synthase complexes with enhanced properties

  • Drug discovery platform:

    • Using atpG-based assays to screen for compounds affecting bacterial energy metabolism

    • Target: Identification of novel antibacterials targeting ATP synthase

    • Methodology: High-throughput screening using reconstituted systems

  • Bioremediation enhancement:

    • Engineering Bradyrhizobium strains with modified energy metabolism for environmental applications

    • Similar to metabolic engineering approaches used with other carbon metabolism pathways in Bradyrhizobium

    • Applications: Enhanced degradation of pollutants, metal sequestration

  • Biosensor development:

    • Creation of ATP-responsive biosensors based on atpG conformational changes

    • Applications: Monitoring cellular energy status, detecting metabolic inhibitors

    • Methodology: Coupling conformational changes to optical or electrical outputs

These applications would build upon the fundamental understanding of atpG structure and function, extending its utility beyond basic research into applied biotechnology fields.

Future Research Directions

Q: What emerging technologies might advance our understanding of atpG structure and function in Bradyrhizobium sp.?

A: Several emerging technologies offer promising avenues to advance our understanding of atpG structure and function in Bradyrhizobium sp.:

  • Cryo-electron microscopy advances:

    • Application: High-resolution structural analysis of intact ATP synthase complexes

    • Advantage: Visualization of atpG in its native context without crystallization

    • Methodological advancement: Single-particle analysis combined with tomography for in situ structural determination

  • Integrative structural biology approaches:

    • Combining X-ray crystallography, NMR, SAXS, and computational modeling

    • Building on existing knowledge of atpG's alpha-helical structure and 90 Å length

    • Creating dynamic models of atpG function within the ATP synthase complex

  • Advanced genetic tools:

    • CRISPR-Cas9 based precise genome editing in Bradyrhizobium

    • Creation of conditional knockdowns for essential components

    • Development of regulatable expression systems for structure-function studies

  • Single-molecule techniques:

    • FRET-based approaches to study conformational changes during ATP synthesis

    • Optical tweezers to measure mechanical forces in the ATP synthase complex

    • Single-molecule tracking in living cells to monitor dynamics

  • Systems biology integration:

    • Multi-omics approaches (transcriptomics, proteomics, metabolomics) to place atpG function in broader cellular context

    • Similar to approaches used to study carbon metabolism in Bradyrhizobium diazoefficiens

    • Network analysis to identify regulatory connections

  • In situ structural approaches:

    • Cryo-electron tomography of bacterial cells

    • Correlative light and electron microscopy

    • In-cell NMR to study protein dynamics in native environment

These emerging technologies, applied in combination, would provide unprecedented insights into how atpG contributes to ATP synthase function and bacterial energy metabolism in the physiologically relevant context of living Bradyrhizobium cells.

Q: What are the most promising directions for understanding the regulatory network controlling atpG expression in Bradyrhizobium sp.?

A: To elucidate the regulatory network controlling atpG expression in Bradyrhizobium sp., several promising research directions can be pursued:

  • Transcriptional regulation mapping:

    • Promoter analysis using reporter gene fusions

    • ChIP-seq to identify transcription factors binding to the atpG promoter region

    • Similar approaches to those used to study regulatory proteins like copG₁ in Bradyrhizobium sp.

    • Systematic mutation of predicted regulatory elements followed by expression analysis

  • Environmental response characterization:

    • Transcriptome analysis under varying conditions (oxygen levels, carbon sources, symbiotic signals)

    • Building on observations of metabolic reprogramming under different carbon sources

    • Time-course studies during transition between free-living and symbiotic states

    • Correlation with energy demand and supply parameters

  • Post-transcriptional regulation:

    • RNA-seq with specific enrichment for small RNAs

    • Investigation of mRNA stability determinants

    • Translational efficiency analysis using ribosome profiling

  • Integration with global regulatory networks:

    • Analysis of how atpG regulation coordinates with other ATP synthase subunits

    • Systems biology approaches to identify key regulatory nodes

    • Network modeling to predict regulatory interactions

  • Comparative genomics:

    • Analysis of regulatory mechanisms across different Bradyrhizobium species

    • Identification of conserved regulatory elements

    • Evolutionary analysis of regulatory circuit development

  • Single-cell approaches:

    • Investigation of cell-to-cell variability in atpG expression

    • Correlation with bacterial cell cycle and differentiation during symbiosis

    • Spatial organization of expression in bacterial colonies and biofilms

These complementary approaches would provide a comprehensive understanding of when, how, and why atpG expression is regulated in response to environmental conditions and developmental stages in Bradyrhizobium sp., potentially revealing novel regulatory mechanisms governing bacterial energy metabolism.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.