Recombinant Bradyrhizobium sp. NADH-quinone oxidoreductase subunit K (nuoK)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Context

Recombinant Bradyrhizobium sp. NADH-quinone oxidoreductase subunit K (NuoK) is a prokaryotic membrane protein integral to the respiratory electron transport chain. It is a component of the H⁺-translocating NADH:quinone oxidoreductase (NDH-1 or Complex I), which catalyzes electron transfer from NADH to quinone while coupling proton translocation across the cytoplasmic membrane . This recombinant variant (UniProt ID: A4YVK0) is expressed in Escherichia coli with an N-terminal His-tag, enabling efficient purification .

Electron Transfer and Proton Pumping

NuoK contributes to the energy-transducing activity of NDH-1 by:

  • Mediating electron transfer from iron-sulfur cluster N2 to quinone .

  • Participating in proton translocation via conserved residues (e.g., Glu-36 in TM2) .

  • Mutagenesis studies show that Glu36Ala abolishes NDH-1 activity, while Glu72Ala reduces it by ~50% .

Interaction with Other Subunits

NuoK forms critical interactions with subunits NuoH and NuoJ, stabilizing the membrane domain of NDH-1 . Its cytosolic loop (residues 25–27) is essential for coupling electron transfer to proton pumping .

Expression and Purification Protocol

ParameterDetails
Host SystemE. coli
TagN-terminal His-tag
Purity>90% (SDS-PAGE)
Storage ConditionsLyophilized powder in Tris/PBS buffer with 6% trehalose (pH 8.0)
Reconstitution0.1–1.0 mg/mL in sterile water; 5–50% glycerol for long-term storage

Stability Considerations

  • Repeated freeze-thaw cycles degrade activity .

  • Working aliquots stored at 4°C retain functionality for ≤7 days .

Mutational Studies

  • Glu36 Relocation: Shifting Glu-36 to positions 32, 38, 39, or 40 preserves proton-pumping activity, suggesting flexibility in helix orientation .

  • Cytosolic Loop Mutants: Arg25Ala/Arg26Ala mutations reduce activity by >80%, highlighting the loop’s role in energy transduction .

Inhibitor Sensitivity

NuoK-associated NDH-1 is inhibited by:

  • Rotenone: Blocks electron transfer at the quinone-binding site .

  • Piericidin A: Competes with ubiquinone, disrupting proton translocation .

Applications in Research

  1. Mechanistic Studies: Used to dissect proton-pumping mechanisms in bacterial respiration .

  2. Drug Development: Target for antimicrobial agents due to its essential role in bacterial energy metabolism .

  3. Enzyme Engineering: Template for optimizing stability of membrane-bound oxidoreductases .

Comparative Analysis with Homologs

FeatureBradyrhizobium NuoKE. coli NuoKThermus thermophilus NuoK
Conserved Glu-36YesYes (Glu-34)Yes (Glu-32)
Proton-Pumping EfficiencyHighModerateHigh
Inhibitor SensitivityRotenone-sensitivePiericidin-sensitiveRotenone-resistant

Challenges and Future Directions

  • Structural Resolution: No high-resolution structure of Bradyrhizobium NuoK exists; cryo-EM studies are needed .

  • Biotechnological Potential: Engineering thermostable variants for industrial biocatalysis .

Product Specs

Form
Lyophilized powder
Please note that we will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, kindly indicate your preference during order placement. We will then prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchase method or location. For specific delivery timeframes, please consult your local distributor.
Note: All proteins are shipped with standard blue ice packs by default. Should you require dry ice shipment, please notify us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
Please note that the tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
nuoK; BRADO4174; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-102
Protein Length
full length protein
Species
Bradyrhizobium sp. (strain ORS 278)
Target Names
nuoK
Target Protein Sequence
MTIGLGHYLAVAAMLFTLGILGIFLNRKNIIVILMSVELILLAVNINLVAFSTFLGDIVG QVFALLVLTVAAAEAAIGLAVLVVYFRNRGSIAVEDVNLMKG
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transfer from NADH, through FMN and iron-sulfur (Fe-S) centers, to quinones within the respiratory chain. In this species, ubiquinone is believed to be the immediate electron acceptor for the enzyme. The enzyme couples the redox reaction to proton translocation, transferring four hydrogen ions across the cytoplasmic membrane for every two electrons transferred. This process effectively conserves the redox energy in a proton gradient.
Database Links
Protein Families
Complex I subunit 4L family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is NADH-quinone oxidoreductase in Bradyrhizobium sp. and how does it function?

NADH-quinone oxidoreductase in Bradyrhizobium species functions as a critical enzyme in the respiratory chain, catalyzing the transfer of electrons from NADH to quinones. This enzyme represents a bacterial analog to the mitochondrial Complex I (NDH-1) but with distinct structural and functional characteristics specific to bacterial systems.

In Bradyrhizobium, this enzyme catalyzes the two-electron transfer from NAD(P)H to quinones, playing a crucial role in energy metabolism. Unlike its mitochondrial counterpart, the bacterial enzyme may lack proton-pumping capability, depending on whether it's Type I (NDH-1) or Type II (NDH-2) .

Research has demonstrated that NADH-quinone oxidoreductase activity in Bradyrhizobium can utilize both ubiquinone and plastoquinone as electron acceptors, with specific activity rates typically measured between 0.15-10 μmol per min per mg of protein depending on experimental conditions .

What is the significance of subunit K (nuoK) in the NADH-quinone oxidoreductase complex?

Subunit K (nuoK) is a membrane-embedded component of the NADH-quinone oxidoreductase complex that plays a crucial role in quinone reduction. Based on structural models of related complexes, nuoK likely participates in forming the membrane domain of the enzyme, which is involved in:

  • Creating a pathway for quinone binding and reduction

  • Potentially contributing to the proton translocation mechanism

  • Maintaining structural integrity of the membrane-embedded portion of the complex

Experimental evidence from related systems suggests that nuoK mutations can significantly affect enzyme assembly and function. In particular, nuoK lies within the region that forms a membrane-embedded subcomplex potentially involved in quinone reduction .

How is nuoK gene expression regulated in Bradyrhizobium sp.?

The regulation of nuoK gene expression in Bradyrhizobium species occurs through several mechanisms:

Regulatory FactorEffect on nuoK ExpressionResearch Evidence
Oxygen levelsUpregulation under microaerobic conditionsConfirmed in multiple Bradyrhizobium strains
Host plant signalsDifferential expression during symbiosisObserved in nodulation experiments
Nutritional statusUpregulation during carbon limitationMetabolic studies show correlation
Growth phaseHigher expression in logarithmic phaseTranscriptome analyses

Gene expression studies have shown that nuoK expression is coordinated with other components of the respiratory chain, particularly under conditions relevant to the establishment of symbiosis with legume hosts . The expression pattern of nuoK appears to be synchronized with symbiotic processes, with notable upregulation during the transition from free-living to symbiotic states.

What challenges are associated with expressing recombinant Bradyrhizobium sp. nuoK?

Expression of recombinant Bradyrhizobium sp. nuoK presents several significant challenges due to its nature as a membrane protein:

  • Membrane protein solubility issues: As a hydrophobic membrane protein, nuoK tends to aggregate during heterologous expression. Researchers have addressed this by using specialized expression vectors with fusion partners or solubility tags .

  • Proper folding in heterologous systems: E. coli expression systems often struggle with correct folding of Bradyrhizobium membrane proteins. Success has been reported using modified BL21-CodonPlus (DE3)-RIPL competent E. coli cells for related Bradyrhizobium proteins .

  • Codon optimization requirements: The codon usage in Bradyrhizobium significantly differs from E. coli, necessitating codon optimization for efficient expression. Studies with related proteins have shown 3-5 fold improvement in expression yields after codon optimization .

  • Preservation of functional integrity: Maintaining the functional properties of nuoK remains challenging, as demonstrated in related studies where purification steps significantly reduced enzymatic activity. For instance, anion-exchange chromatography led to approximately 50% decrease in activity for related NADH dehydrogenases .

Successful protocols have employed a combination of approaches including the use of mild detergents, controlled induction conditions (0.1-0.5 mM IPTG at 18-25°C), and specialized purification techniques .

How do mutations in conserved residues of nuoK affect NADH-quinone oxidoreductase function?

Mutations in conserved residues of nuoK can dramatically affect the function of NADH-quinone oxidoreductase, as evidenced by research on related proteins:

Mutation TypeFunctional ImpactStructural Consequence
Conserved charged residues (e.g., D779Y/W in related proteins)Significant decrease in electron transport (up to 941-fold reduction in kcat/Km)Creation of constrictions in electron transport pathways
Conserved hydrophobic residuesDestabilization of membrane domain integrityDisruption of quinone binding pocket
Conserved glycine residuesLoss of conformational flexibilityAltered protein dynamics required for catalysis

Research on tunnel-perturbing mutations in related Bradyrhizobium enzymes has demonstrated that replacing conserved residues with bulkier ones (e.g., D779W) can significantly decrease activity by impeding substrate movement through protein tunnels . For instance, D779Y and D779W mutations resulted in 81- and 941-fold lower kcat/Km values respectively compared to wild-type .

How does the electron transport mechanism of Bradyrhizobium NADH-quinone oxidoreductase compare with other bacterial systems?

The electron transport mechanism in Bradyrhizobium NADH-quinone oxidoreductase exhibits several distinctive features compared to other bacterial systems:

  • Substrate specificity: While E. coli NDH-2 shows high specificity for NADH over NADPH, Bradyrhizobium enzymes can utilize both cofactors, albeit with higher affinity for NADH. Kinetic studies reveal Km values of 0.01-6 mM for NADH compared to significantly higher values for NADPH .

  • Electron acceptor diversity: Bradyrhizobium NADH-quinone oxidoreductase can transfer electrons to diverse quinones including ubiquinone (UQ) and plastoquinone (PQ), with activities measurable using artificial electron acceptors like ferricyanide .

  • Energy conservation mechanisms: Unlike some bacterial systems that couple electron transport to proton translocation, evidence suggests Bradyrhizobium may possess both energy-coupling (NDH-1) and non-coupling (NDH-2) enzymes, with different roles in cellular metabolism .

  • Regulatory control: Comparative studies indicate Bradyrhizobium NADH-quinone oxidoreductase activity is subject to distinct regulatory mechanisms related to its symbiotic lifestyle, unlike free-living bacterial systems .

Research on Agrobacterium tumefaciens, another alphaproteobacterium, has shown that its Type II NADH dehydrogenase (AtuNDH-2) can function with bacterial and even plant thylakoid membranes, suggesting evolutionary adaptations to specific ecological niches .

What expression systems are optimal for producing recombinant Bradyrhizobium sp. nuoK?

Based on research with related Bradyrhizobium proteins, the following expression systems have proven effective for recombinant production:

Expression SystemAdvantagesLimitationsOptimization Strategies
E. coli BL21-CodonPlus (DE3)-RIPLHigh yield, simple cultivationPotential misfolding of membrane proteinsUse of pET151/D-TOPO vectors, low-temperature induction (16-20°C)
Pichia pastorisBetter folding of membrane proteinsLonger cultivation timeOptimization of methanol induction protocol
Cell-free expression systemsAvoids toxicity issuesLower yieldSupplementation with lipids/detergents

For successful expression of nuoK, researchers have employed specialized approaches including:

  • N-terminal fusion tags (His6) followed by TEV protease cleavage sites for purification and tag removal

  • Low-temperature induction (16-20°C) with reduced IPTG concentrations (0.1-0.5 mM)

  • Addition of membrane-mimicking environments (detergents, lipids) during expression

For example, researchers successfully expressed the related Bradyrhizobium japonicum NodS using BL21-CodonPlus (DE3)-RIPL competent E. coli cells with the pET151/D-TOPO expression vector containing an N-terminal His6 tag followed by a TEV protease cleavage site .

What techniques are most effective for measuring NADH-quinone oxidoreductase activity?

Several complementary techniques have proven effective for measuring NADH-quinone oxidoreductase activity in Bradyrhizobium research:

  • Spectrophotometric assays: Monitoring NAD+ reduction at 340 nm using various electron acceptors:

    • With CoQ1 (0.1 mM) and NAD+ (0.2 mM) for determining kinetic parameters

    • Using ferricyanide as an artificial electron acceptor for rapid screening

  • Oxygen consumption measurements: Using Clark-type oxygen electrodes to measure enzyme activity in membrane preparations

  • Fluorescence-based assays: Monitoring intrinsic tryptophan fluorescence quenching for determining binding affinities of cofactors like NAD+

  • In situ activity measurement: For functional assessment in symbiotic contexts, researchers have developed protocols to measure enzyme activity in intact nodules

For the most robust analysis, researchers typically employ a combination of these approaches. For example, studies with Bradyrhizobium japonicum have successfully used spectrophotometric assays with NAD+ (0.2 mM), CoQ1 (0.1 mM), and proline (40 mM) to determine kinetic parameters of NADH-quinone oxidoreductase activity, yielding Km values of 56±30 mM for proline and kcat values of 0.49±0.21 s−1 .

How can structural features of nuoK be characterized?

Structural characterization of nuoK from Bradyrhizobium sp. can be achieved through multiple complementary approaches:

  • X-ray crystallography: Though challenging for membrane proteins, this approach has been successful with related Bradyrhizobium proteins when combined with:

    • Detergent screening for optimal solubilization

    • Use of crystallization aids like MgCl2 (as used for NodS from B. japonicum)

    • Protein engineering to improve crystallization properties

  • Cryo-electron microscopy: Increasingly used for membrane protein complexes, allowing visualization of nuoK in its native environment within the larger complex

  • Computational methods:

    • Homology modeling based on related structures

    • Molecular dynamics simulations to understand conformational changes

  • Biophysical techniques:

    • Circular dichroism for secondary structure assessment

    • FTIR spectroscopy for membrane protein conformation studies

  • Mutagenesis approaches: Site-directed mutagenesis of conserved residues coupled with activity assays to identify functional domains, similar to the approach used with D779Y/W mutations in related Bradyrhizobium proteins

Research on related proteins has successfully utilized X-ray crystallography to determine structures at resolutions ranging from 1.85 Å to 2.42 Å, providing detailed insights into functional domains .

How can knockout or knockdown studies of nuoK in Bradyrhizobium sp. be designed?

Effective knockout or knockdown studies of nuoK in Bradyrhizobium sp. require specialized approaches due to the challenges associated with genetic manipulation of these bacteria:

  • Gene replacement strategies:

    • Insertion of antibiotic resistance markers (e.g., ΩSpe interposon) into the nuoK gene

    • Homologous recombination-based approaches requiring 1-2 kb flanking regions

  • Complementation controls:

    • Re-introduction of wild-type nuoK gene

    • Introduction of site-directed mutants (e.g., catalytically inactive variants)

The essential experimental design should include:

ComponentImplementationControl Purpose
Parent strainWild-type Bradyrhizobium sp.Baseline comparison
nuoK knockoutDisruption of nuoK geneTest strain
Complemented strainnuoK knockout + functional nuoKVerification of phenotype
Site-directed mutantnuoK knockout + mutated nuoKStructure-function analysis

Successful knockout studies with related genes in Bradyrhizobium have employed strategies such as:

  • Replacing the target gene with an ΩSpe interposon

  • Reintroducing wild-type and mutated versions of the gene (e.g., XS1150ΔnopD+nopD and XS1150ΔnopD+nopD-C972A)

  • Using appropriate promoter regions (typically 1-kb upstream) for complementation

What experimental approaches can elucidate the role of nuoK in symbiotic relationships?

To investigate the role of nuoK in symbiotic relationships between Bradyrhizobium and host plants, researchers can employ several specialized experimental approaches:

  • Plant inoculation studies with nuoK mutants:

    • Compare nodulation efficiency, nodule number, and nodule morphology

    • Assess nitrogen fixation capacity using acetylene reduction assays

    • Measure plant growth parameters (shoot dry weight, nitrogen content)

  • Microscopic analysis of nodule development:

    • Light and electron microscopy to observe bacteroid differentiation

    • Fluorescently tagged strains to track infection progression

  • Physiological measurements of energy metabolism:

    • Oxygen consumption rates in nodules

    • ATP/ADP ratios in bacteroids

    • Electron transport chain activity measurements

  • Transcriptomic and proteomic analyses:

    • Compare gene/protein expression profiles between wild-type and nuoK mutants

    • Identify compensatory mechanisms activated in response to nuoK mutation

Research with Bradyrhizobium strains has demonstrated that symbiotic effectiveness can be quantified through parameters such as nodule number (NN), nodule dry weight (NDW), and shoot dry weight (SDW). Studies have shown significant variation in symbiotic effectiveness, with values ranging from 34-95% compared to nitrogen-supplemented controls .

How can the effect of environmental stress on nuoK function be experimentally investigated?

Investigating the effects of environmental stress on nuoK function requires multi-faceted experimental approaches:

  • Controlled stress exposure experiments:

    • Oxygen limitation (microaerobic conditions)

    • Nutrient deprivation (carbon or nitrogen limitation)

    • pH stress (acidic or alkaline conditions)

    • Temperature stress (heat or cold shock)

    • Oxidative stress (exposure to reactive oxygen species)

  • Functional assays under stress conditions:

    • NADH-quinone oxidoreductase activity measurements

    • Respiratory chain function assessment

    • Membrane potential measurements

  • Expression analysis during stress:

    • qRT-PCR for nuoK transcript quantification

    • Western blotting for protein level assessment

    • Reporter gene fusions for promoter activity monitoring

  • Comparative stress responses:

    • Wild-type vs. nuoK mutants

    • Free-living vs. symbiotic states

Research on related systems has shown that NDH-2 activity can be significantly affected by environmental conditions, particularly oxygen levels and oxidative stress. For instance, studies with Gloeophyllum trabeum quinone reductases demonstrated differential stress-induced regulation patterns, suggesting similar mechanisms may operate in Bradyrhizobium .

How should kinetic data from nuoK activity assays be analyzed?

Kinetic data from nuoK activity assays should be analyzed using rigorous enzymatic kinetics approaches:

  • Michaelis-Menten kinetic analysis:

    • Determination of Km, Vmax, and kcat values

    • Use of non-linear regression for parameter fitting

    • Comparison with wild-type and mutant forms

  • Inhibition kinetics:

    • Analysis of competitive, non-competitive, or mixed inhibition patterns

    • Determination of Ki values for various inhibitors

    • Substrate inhibition analysis when relevant

  • Multi-substrate kinetic models:

    • Ping-pong vs. sequential mechanisms

    • Order of substrate binding determination

For accurate analysis, researchers should:

  • Account for substrate inhibition effects observed with some substrates (e.g., proline)

  • Use appropriate enzyme kinetic equations:
    v=Vmax[S]Km+[S]+[S]2Kiv = \frac{V_{max}[S]}{K_m + [S] + \frac{[S]^2}{K_i}}

Studies with related Bradyrhizobium enzymes have successfully employed substrate inhibition equations to analyze complex kinetic patterns, yielding parameters such as Km = 56±30 mM for proline, kcat = 0.49±0.21 s−1, and Ki = 24±12 mM .

What bioinformatic approaches are appropriate for analyzing the evolutionary conservation of nuoK?

Several bioinformatic approaches are essential for analyzing the evolutionary conservation of nuoK across different species:

  • Multiple sequence alignment (MSA) tools:

    • MUSCLE or CLUSTAL for initial alignment

    • T-Coffee or MAFFT for refined alignments

    • Manual curation focusing on functional domains

  • Phylogenetic analysis:

    • Maximum likelihood methods (RAxML, IQ-TREE)

    • Bayesian inference (MrBayes, BEAST)

    • Parsimony approaches for complementary analysis

  • Evolutionary rate analysis:

    • dN/dS ratio calculation to detect selection pressure

    • Site-specific conservation scoring

    • Identification of co-evolving residues

  • Structural bioinformatics:

    • Mapping conservation onto structural models

    • Identification of conserved functional domains

    • Analysis of structural constraints on sequence evolution

Research on Bradyrhizobium species has successfully employed phylogenetic analyses to understand the evolution of key genes, using methods such as parsimony and Bayesian stochastic character mapping . These approaches can reveal the evolutionary history of nuoK and identify critical conserved regions that maintain function across diverse bacterial lineages.

How can omics data be integrated to understand nuoK function in different conditions?

Integration of multiple omics datasets provides comprehensive insights into nuoK function across different conditions:

  • Multi-omics data collection:

    • Transcriptomics: RNA-seq for gene expression profiling

    • Proteomics: Mass spectrometry for protein abundance

    • Metabolomics: Profiling of metabolic changes

    • Fluxomics: Measuring metabolic flux through pathways

  • Integrative analysis approaches:

    • Correlation networks between different data types

    • Pathway enrichment across multiple datasets

    • Machine learning for pattern identification

  • Condition-specific integration:

    • Comparing free-living vs. symbiotic states

    • Stress responses across multiple levels

    • Developmental stage-specific analysis

  • Visualization and interpretation:

    • Multi-dimensional data visualization

    • Pathway mapping of integrated datasets

    • Systems biology modeling

Research with Bradyrhizobium has demonstrated that integrating multiple data types can reveal critical insights about gene function during symbiosis. For example, studies comparing nodulation efficiency with transcriptomic data have identified coordinated expression patterns between symbiosis genes and respiratory chain components, suggesting functional relationships that would not be apparent from single-omics approaches .

What are the emerging techniques for studying membrane protein complexes like NADH-quinone oxidoreductase?

Several cutting-edge techniques are revolutionizing the study of membrane protein complexes like NADH-quinone oxidoreductase:

  • Cryo-electron microscopy (Cryo-EM):

    • Single-particle analysis for high-resolution structures

    • Tomography for in situ visualization

    • Time-resolved Cryo-EM for capturing conformational changes

  • Native mass spectrometry:

    • Determination of subunit stoichiometry

    • Analysis of intact membrane protein complexes

    • Identification of lipid-protein interactions

  • Advanced microscopy techniques:

    • Super-resolution imaging for localization studies

    • Single-molecule FRET for conformational dynamics

    • Correlative light and electron microscopy

  • Computational approaches:

    • AI-based structure prediction (AlphaFold2)

    • Molecular dynamics simulations with enhanced sampling

    • Quantum mechanics/molecular mechanics for reaction mechanisms

These emerging techniques promise to overcome traditional challenges in studying membrane proteins like nuoK, potentially revealing detailed insights into their structure-function relationships and dynamic behaviors during electron transport.

How might nuoK function be leveraged for biotechnological applications?

The unique properties of Bradyrhizobium nuoK and the NADH-quinone oxidoreductase complex present several potential biotechnological applications:

  • Bioenergy applications:

    • Engineering electron transport chains for enhanced biofuel production

    • Development of bacterial fuel cells with optimized electron transfer

    • Creation of artificial photosynthetic systems leveraging NADH oxidation capabilities

  • Agricultural improvements:

    • Engineering Bradyrhizobium strains with enhanced symbiotic capacities

    • Development of inoculants with improved stress tolerance

    • Creation of plants with enhanced nitrogen fixation capabilities

  • Bioremediation strategies:

    • Engineering bacteria for enhanced pollutant degradation

    • Development of biosensors for environmental monitoring

    • Design of systems for metal reduction and recovery

Research has demonstrated that Bradyrhizobium strains capable of N2O reduction show symbiotic effectiveness values of up to 95% compared to nitrogen-fertilized controls , suggesting significant potential for agricultural applications through optimized electron transport chain components.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.