Recombinant Bradyrhizobium sp. Probable intracellular septation protein A (BBta_0376)

Shipped with Ice Packs
In Stock

Description

Introduction to Bradyrhizobium sp. and BBta_0376

Bradyrhizobium sp. BTAi1 (ATCC BAA-1182) is a nitrogen-fixing bacterium with a complete genome sequence spanning approximately 8,264,687 base pairs . Within this extensive genome, the gene BBta_0376 has been identified and characterized as encoding the probable intracellular septation protein A. According to the genomic data available, BBta_0376 is positioned at coordinates 375321 to 375923 on the positive strand of the Bradyrhizobium sp. BTAi1 genome .

The classification of BBta_0376 as an intracellular septation protein suggests its involvement in bacterial cell division processes, specifically in the formation of the septum that physically divides the bacterial cell during binary fission. This process is fundamental to bacterial reproduction and survival, making septation proteins critical components of bacterial cellular machinery. Understanding the structure and function of BBta_0376 can provide valuable insights into the cell division mechanisms of Bradyrhizobium species and potentially contribute to broader knowledge of bacterial physiology.

The study of proteins like BBta_0376 contributes to our fundamental understanding of bacterial cell biology and may have implications for agricultural applications, considering the importance of Bradyrhizobium species in nitrogen fixation and plant symbiosis. Furthermore, insights into bacterial cell division mechanisms could potentially inform the development of novel antimicrobial strategies targeting this essential process in pathogenic bacteria.

Protein Characteristics

The BBta_0376 protein is cataloged in the UniProt database with the accession number A5E919 . Based on the available information, the following table summarizes the key characteristics of this protein:

CharacteristicInformation
Protein NameProbable intracellular septation protein A
Gene NameBBta_0376
OrganismBradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182)
Genome Location375321 - 375923 (+)
UniProt IDA5E919
Expression Region1-200
Storage BufferTris-based buffer, 50% glycerol
Storage Recommendation-20°C; for extended storage, -20°C or -80°C
Sequence Length200 amino acids

The protein appears to be fully expressed from the gene, covering amino acids 1-200 as indicated in the commercial product information . The storage recommendations and buffer composition reflect the conditions necessary for maintaining protein stability for research applications.

Role in Cell Division

As an intracellular septation protein, BBta_0376 is likely involved in the critical process of bacterial cell division. During binary fission, bacteria form a septum at the midpoint of the cell, which gradually constricts to physically separate the cytoplasm of the two daughter cells. Septation proteins facilitate this process by contributing to the formation and constriction of the septum.

  1. Initiating septum formation at the appropriate cellular location

  2. Recruiting additional proteins to the division site

  3. Facilitating membrane invagination during septum constriction

  4. Coordinating peptidoglycan synthesis at the division site

Further experimental studies would be necessary to elucidate the precise role of BBta_0376 in these processes.

Membrane Association and Topology

The amino acid sequence of BBta_0376 contains multiple hydrophobic regions that suggest membrane association . These hydrophobic stretches likely form transmembrane domains that anchor the protein within the bacterial cell membrane. The topology of BBta_0376 with respect to the membrane (which portions are exposed to the cytoplasm, periplasm, or embedded within the membrane) would require experimental determination.

This membrane association is significant because septum formation involves extensive remodeling of the cell membrane. By being integrated into the membrane, BBta_0376 would be optimally positioned to participate in the membrane dynamics associated with cell division. Additionally, its membrane localization could facilitate interactions with other division-related proteins, many of which are also membrane-associated.

Recombinant Protein Production

BBta_0376 is commercially available as a recombinant protein specifically designed for research applications. The commercial product is provided as an ELISA Recombinant Bradyrhizobium sp. Probable intracellular septation protein A (BBta_0376) at a quantity of 50 μg, with other quantities also available upon request .

The recombinant protein is supplied in a Tris-based buffer containing 50% glycerol, which has been optimized for the stability of this specific protein . According to the product information, the recombinant protein should be stored at -20°C, with -20°C or -80°C recommended for extended storage. The product notes also advise against repeated freezing and thawing, suggesting that working aliquots should be stored at 4°C for up to one week .

The tag type for the recombinant protein is determined during the production process, which may affect certain experimental applications, particularly those involving protein purification or detection.

Research Applications and Methodologies

The commercial availability of recombinant BBta_0376 enables various research applications. The following table outlines potential research applications and corresponding methodologies for studying this protein:

Research ApplicationMethodologyExpected Outcomes
ImmunodetectionELISA, Western BlotQuantification and detection of BBta_0376 in bacterial samples
Localization StudiesImmunofluorescence MicroscopyDetermination of subcellular localization during cell cycle
Structural AnalysisX-ray Crystallography, NMRThree-dimensional structure determination
Interaction StudiesPull-down Assays, Co-immunoprecipitationIdentification of protein binding partners
Functional AssaysIn vitro ReconstitutionAssessment of membrane binding and remodeling activities

These research applications represent potential avenues for advancing our understanding of BBta_0376 and its role in bacterial cell division. The commercial availability of the recombinant protein facilitates these studies by providing a reliable source of purified protein for experimental use.

ELISA Applications

The specific formulation of the commercial product as an "ELISA Recombinant" suggests its suitability for enzyme-linked immunosorbent assay applications . ELISA is a powerful immunological technique used for detecting and quantifying specific proteins in complex samples. In the context of BBta_0376 research, ELISA applications could include:

  1. Determining protein expression levels under different growth conditions

  2. Monitoring protein production during different stages of the bacterial cell cycle

  3. Screening for antibodies that specifically recognize BBta_0376

  4. Developing diagnostic tools for detecting Bradyrhizobium sp. in environmental or agricultural samples

The availability of a standardized recombinant form of BBta_0376 enhances the reproducibility and reliability of such immunological studies.

Functional Characterization

Functional studies represent another important area for future research on BBta_0376. Such studies might include:

  1. Gene knockout or depletion experiments to observe the effects of BBta_0376 absence on cell division and bacterial growth

  2. Site-directed mutagenesis to identify critical residues for function

  3. Protein-protein interaction studies to map the network of BBta_0376 binding partners

  4. Live-cell imaging to track the dynamics of BBta_0376 localization during the cell cycle

These approaches would provide insights into the specific role of BBta_0376 in septum formation and potentially reveal additional functions beyond its presumed role in cell division.

Comparative Genomic Analysis

Comparative genomic analysis of BBta_0376 homologs across different bacterial species could provide valuable evolutionary insights. By examining the sequence conservation, gene neighborhood, and phylogenetic distribution of BBta_0376-like proteins, researchers could infer the evolutionary history of this protein family and potentially identify functionally important regions under selective pressure.

Such comparative analyses might also reveal species-specific adaptations in septation proteins that reflect differences in cell division mechanisms across diverse bacterial lineages. Additionally, understanding the distribution of BBta_0376 homologs could provide insights into the conservation of cell division mechanisms across the bacterial kingdom.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it during order placement, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timeframe.
Note: Our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid form has a shelf life of 6 months at -20°C/-80°C, while lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
yciB; BBta_0376; Inner membrane-spanning protein YciB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-200
Protein Length
full length protein
Species
Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182)
Target Names
BBta_0376
Target Protein Sequence
MDKTQPHPLFKLATELGPLIVFFVVNAKFNLFAATGAFMVAIVAAMIASYVVTKHVPLMA IVTGIVVLVFGTLTLVLHDETFIKLKPTIIYGLFAAVLGGGLLFNRSFIAIMFDQMFNLT PAGWRILTFRWALFFAAMAVLNEIIWRTQSTDFWVGFKAFGVVPLTMIFAIAQMPLIKRY HQDPASLEASDAAEGDVSKG
Uniprot No.

Target Background

Function
Plays a role in cell envelope biogenesis, maintenance of cell envelope integrity, and membrane homeostasis.
Database Links
Protein Families
YciB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Bradyrhizobium sp. Probable intracellular septation protein A (BBta_0376)?

Bradyrhizobium sp. Probable intracellular septation protein A (BBta_0376) is a 200-amino acid protein classified under KEGG Orthology (KO) designation K06190 as an intracellular septation protein . It belongs to the ispA/ispZ family and is characterized as a putative membrane protein in Bradyrhizobium sp. BTAi1. The protein contains the Pfam domain IspA and likely plays a role in bacterial cell division, specifically in the formation of septa during cellular replication. The protein's sequence suggests membrane-spanning domains consistent with its predicted function in septation processes.

How does BBta_0376 relate to the broader context of Bradyrhizobium research?

BBta_0376 research contributes significantly to understanding the fundamental cellular processes in Bradyrhizobium species, which are agriculturally important bacteria that fix nitrogen symbiotically with soybeans . Recent studies have identified at least 74 species of Bradyrhizobium within soil and rhizosphere communities . Understanding BBta_0376's role in cellular division provides insights into how these bacteria proliferate in soil environments and potentially how they establish symbiotic relationships. The septation process influences bacterial morphology, growth rates, and potentially adaptation to environmental conditions in the rhizosphere, which could impact their effectiveness as nitrogen-fixing symbionts in agricultural systems.

What methodological approaches can differentiate BBta_0376 from other septation proteins?

To differentiate BBta_0376 from other septation proteins, researchers should implement a multi-faceted approach combining sequence analysis, structural studies, and functional characterization. Begin with phylogenetic analysis comparing BBta_0376 sequences across Bradyrhizobium species while also examining homologs in related rhizobial genera. For structural differentiation, prediction tools specifically optimized for membrane proteins can identify unique structural features compared to other septation proteins. Experimentally, generate BBta_0376-specific antibodies for western blotting and immunofluorescence to track the protein's expression and localization patterns throughout the cell cycle. Functional differentiation can be achieved through complementation studies in mutants lacking different septation proteins, determining which phenotypes BBta_0376 can rescue. For definitive characterization, CRISPR-based gene editing to create precise mutations in functional domains can reveal BBta_0376-specific activities in septation processes.

What expression systems are most suitable for producing recombinant BBta_0376?

For recombinant production of BBta_0376, researchers should consider expression system selection based on the protein's membrane-associated nature and downstream applications. For structural studies requiring high yields, E. coli-based expression using specialized strains like C41(DE3) or C43(DE3) designed for membrane proteins offers a good starting point. These strains contain mutations that prevent toxicity associated with membrane protein overexpression. The pET vector system with a C-terminal His-tag is recommended, as BBta_0376's N-terminus may be involved in membrane interactions based on its annotation .

For functional studies, expression in bacterial species more closely related to Bradyrhizobium, such as Rhizobium or Sinorhizobium, may provide more native-like folding conditions, though with lower yields. For difficult expression cases, consider cell-free protein synthesis systems supplemented with lipids or detergents that can directly incorporate the protein into membrane mimetics.

The expression conditions should be optimized through a systematic approach testing different temperatures (16-30°C), induction conditions (IPTG concentration for pET systems), and growth media compositions. Validation of proper expression should include both SDS-PAGE analysis and western blotting targeting the affinity tag and, if available, the protein itself using specific antibodies.

What purification strategies are most effective for membrane-associated proteins like BBta_0376?

Purifying membrane-associated proteins like BBta_0376 requires a specialized workflow that maintains protein stability while extracting it from the lipid bilayer. Begin with optimized cell lysis methods—either sonication or pressure homogenization—performed in buffer containing protease inhibitors to prevent degradation. Isolate the membrane fraction through differential ultracentrifugation (typically 100,000×g for 1 hour) to separate membrane components from soluble proteins.

For membrane protein solubilization, conduct a detergent screen testing mild non-ionic detergents such as n-dodecyl-β-D-maltoside (DDM), lauryl maltose neopentyl glycol (LMNG), or digitonin at concentrations just above their critical micelle concentration. Once solubilized, purify BBta_0376 using immobilized metal affinity chromatography (IMAC) with the His-tag mentioned in section 2.1, followed by size exclusion chromatography to remove aggregates and obtain homogeneous protein preparations.

Throughout purification, monitor protein stability using techniques like dynamic light scattering or thermal shift assays. For functional studies, consider reconstituting the purified protein into proteoliposomes or nanodiscs to provide a more native-like membrane environment. This approach is particularly important when studying membrane proteins like BBta_0376 that may require specific lipid interactions for proper function.

How can researchers assess the functional activity of purified BBta_0376?

Assessing the functional activity of purified BBta_0376 requires appropriate assays that reflect its role in septation. Since direct enzymatic assays may not be applicable for a structural protein involved in septation, researchers should consider the following methodological approaches:

  • Membrane binding assays: Quantify binding of purified BBta_0376 to artificial liposomes using techniques such as surface plasmon resonance (SPR) or microscale thermophoresis (MST). Varying lipid compositions can reveal lipid preferences that may be physiologically relevant.

  • Protein-protein interaction studies: Identify binding partners from Bradyrhizobium cell lysates using pull-down assays followed by mass spectrometry. Validate these interactions using techniques like isothermal titration calorimetry (ITC) or bio-layer interferometry (BLI) with purified interaction partners.

  • In vitro reconstitution: Attempt to reconstitute minimal septation complexes using purified BBta_0376 and other septation proteins, visualizing complex formation through negative-stain electron microscopy or atomic force microscopy.

  • Functional complementation: Express the purified protein in BBta_0376-depleted cells and assess restoration of normal septation through microscopy-based assays examining cell morphology and division patterns.

  • Structural changes upon binding: Monitor conformational changes upon interaction with lipids or other proteins using techniques like circular dichroism spectroscopy or hydrogen-deuterium exchange mass spectrometry.

For all functional assays, include appropriate negative controls such as heat-denatured protein or mutated versions of BBta_0376 with alterations in predicted functional domains.

What computational approaches are most effective for predicting BBta_0376 structure and function?

Functional prediction should combine sequence-based approaches like conserved domain analysis using InterPro and CDD with structure-based methods like ProFunc or COACH that identify binding pockets and potential interaction surfaces. Molecular dynamics simulations in explicit membrane environments can further refine structural predictions and provide insights into dynamics relevant to function. Coevolutionary analysis using methods like EVcouplings or RaptorX-Contact can identify residue pairs that have coevolved, suggesting functional importance or interaction interfaces.

The table below summarizes computational approaches for different aspects of BBta_0376 analysis:

Analysis TypeRecommended ToolsExpected Outcomes
Transmembrane topologyTMHMM, Phobius, MEMSATIdentification of membrane-spanning regions
3D structure predictionAlphaFold2, RoseTTAFoldFull-atom 3D model with confidence scores
RefinementCHARMM-GUI Membrane Builder, GROMACSMembrane-embedded structure models
Functional annotationInterPro, CDD, ProFuncPotential functional sites and domains
Coevolutionary analysisEVcouplings, RaptorX-ContactResidue pairs with functional importance
Molecular dynamicsGROMACS, NAMD, AmberDynamic behavior in membrane environment

How can researchers identify and validate protein interaction partners of BBta_0376?

Identifying and validating protein interaction partners of BBta_0376 requires a strategic combination of high-throughput screening and targeted validation techniques. Begin with proximity-based labeling approaches such as BioID or APEX2, where BBta_0376 is fused to a biotin ligase or peroxidase that biotinylates nearby proteins in vivo. This allows capture of transient interactions that might occur during the dynamic process of septation. After streptavidin pulldown, identify biotinylated proteins using mass spectrometry.

For direct interaction validation, implement the following methodological workflow:

  • Co-immunoprecipitation using BBta_0376-specific antibodies or epitope tags, followed by western blotting for suspected interaction partners.

  • Bacterial two-hybrid assays to test direct interactions between BBta_0376 and candidate partners in a cellular context.

  • Microscopy-based colocalization studies using fluorescently tagged proteins to determine if BBta_0376 and its partners occupy the same subcellular locations during cell division.

  • In vitro binding assays with purified components using techniques like surface plasmon resonance (SPR), isothermal titration calorimetry (ITC), or microscale thermophoresis (MST) to determine binding affinities and kinetics.

  • Crosslinking mass spectrometry to map specific interaction interfaces between BBta_0376 and its partners at amino acid resolution.

For each interaction, implement appropriate negative controls and statistical analysis to distinguish specific from non-specific interactions. Use known septation proteins as positive controls when possible. Finally, validate functional relevance through genetic approaches such as synthetic lethality screening or phenotypic analysis of double mutants.

What experimental approaches can determine the membrane topology of BBta_0376?

Determining the membrane topology of BBta_0376 requires specialized experimental approaches that can distinguish which portions of the protein are exposed to different cellular compartments. Implement the following methodological workflow:

  • Substituted cysteine accessibility method (SCAM): Introduce cysteine residues at various positions in a cysteine-free variant of BBta_0376, then use membrane-impermeable sulfhydryl-reactive reagents to determine which cysteines are accessible from different sides of the membrane.

  • Fusion reporter assays: Create fusion constructs with reporters such as alkaline phosphatase (PhoA) or green fluorescent protein (GFP) at different positions within the BBta_0376 sequence. PhoA is only active when located in the periplasm, while GFP fluoresces efficiently only in the cytoplasm, providing complementary topology information.

  • Protease protection assays: Prepare membrane vesicles containing BBta_0376, then treat with proteases in the presence or absence of membrane-disrupting detergents. Analyze the resulting fragments by western blotting with domain-specific antibodies to determine which regions were protected by the membrane.

  • Glycosylation mapping: Introduce potential N-glycosylation sites throughout BBta_0376 and express in a system capable of glycosylation. Sites exposed to glycosylation machinery will be modified, creating detectable mobility shifts on SDS-PAGE.

  • Crosslinking experiments: Use membrane-impermeable crosslinkers to identify regions accessible from outside the cell.

Combine these approaches to build a comprehensive topology model, as each method has different strengths and limitations. Use computational predictions from section 3.1 to guide experimental design, focusing on ambiguous regions. For visualization of the results, create a topology map showing membrane-spanning regions and the orientation of loops relative to the membrane.

How can researchers interpret conflicting results between in silico predictions and experimental data for BBta_0376?

When faced with conflicting results between computational predictions and experimental data for BBta_0376, researchers should implement a systematic reconciliation approach. First, critically evaluate the computational models used, particularly whether they were appropriate for membrane proteins like BBta_0376. General protein prediction algorithms often perform poorly on membrane proteins because they're trained predominantly on soluble proteins. Consider using specialized membrane protein prediction tools and evaluate the confidence scores associated with predictions.

For experimental data, assess potential limitations in the methodologies used. For example, protein tags may interfere with membrane insertion, or heterologous expression systems might lack chaperones required for proper folding. Re-evaluate experimental conditions, particularly detergent selection during purification, as inappropriate detergents can disrupt native structure.

To resolve contradictions, design targeted experiments that directly address specific discrepancies. Use complementary techniques that probe the same structural feature through different physical principles. For instance, if transmembrane prediction conflicts with experimental topology mapping, combine substituted cysteine accessibility method (SCAM) with reporter fusion assays and protease protection assays.

Consider the dynamic nature of BBta_0376, as membrane proteins often undergo conformational changes during function. Time-resolved experiments or studies under different physiological conditions may reveal that both computational predictions and experimental results are correct but represent different functional states of the protein.

Finally, validate findings in the native Bradyrhizobium context whenever possible, as protein behavior in heterologous systems may not fully recapitulate native function due to differences in membrane composition or interaction partners.

What statistical approaches are most appropriate for analyzing protein-protein interaction data involving BBta_0376?

For analyzing protein-protein interaction data involving BBta_0376, researchers should employ statistical approaches tailored to the specific experimental method used to generate the data. For high-throughput approaches like affinity purification-mass spectrometry (AP-MS), implement the SAINT (Significance Analysis of INTeractome) algorithm to differentiate true interactions from background contaminants. This approach assigns probability scores to potential interactions based on spectral counts compared to control purifications. Apply the Benjamini-Hochberg procedure for false discovery rate control, typically setting an FDR threshold of 0.05 or 0.01 depending on desired stringency.

For direct binding assays (SPR, ITC, MST), apply non-linear regression to determine binding constants, comparing different binding models (one-site, two-site, cooperative binding) using the Akaike Information Criterion (AIC) or F-tests to select the most appropriate model. Calculate confidence intervals for binding parameters using bootstrap analysis with at least 1000 resampling iterations.

For microscopy-based co-localization studies, calculate Pearson's or Mander's correlation coefficients between fluorescence intensity distributions of BBta_0376 and potential interaction partners. Implement randomization tests by generating artificially rotated or shifted images to establish significance thresholds for correlation coefficients.

The table below summarizes appropriate statistical methods for different experimental approaches:

Experimental ApproachStatistical MethodParameters to ReportSignificance Thresholds
AP-MSSAINT algorithmSAINT score, FDRSAINT score ≥ 0.8, FDR ≤ 0.05
Y2H/B2H screeningFisher's exact testOdds ratio, p-valuep < 0.05 after multiple testing correction
SPR/ITC/MSTNon-linear regressionKd, kon, koff with 95% CIModel comparison via AIC or F-test
Co-localizationPearson's/Mander's coefficientR-value, p-valueR > 0.7, p < 0.05 vs. randomized control
FRETE-FRET calculationFRET efficiency, distanceComparison to negative controls

How can researchers differentiate between direct and indirect effects when studying BBta_0376 knockout phenotypes?

Differentiating between direct and indirect effects in BBta_0376 knockout phenotypes requires a multi-faceted experimental approach with appropriate controls and time-resolved analysis. Implement the following methodological framework:

  • Temporal analysis: Document phenotypes at multiple time points after BBta_0376 depletion or inactivation. Direct effects typically manifest rapidly (minutes to hours), while indirect effects emerge later (hours to days) as consequences cascade through cellular networks. Use time-lapse microscopy to track morphological changes in individual cells or implement time-series transcriptomics/proteomics to capture molecular responses.

  • Complementation studies: Create a conditional complementation system where wild-type BBta_0376 can be reintroduced at different time points after knockout. Direct phenotypes should be rapidly rescued upon protein restoration, while indirect effects may require longer recovery periods.

  • Domain-specific mutations: Generate variants of BBta_0376 with mutations in specific functional domains rather than complete knockouts. This approach can dissect which protein features are responsible for particular phenotypes, helping distinguish primary functions from secondary consequences.

  • Synthetic lethality analysis: Systematically combine BBta_0376 mutations with mutations in other genes to create an interaction network. Direct functional relationships often manifest as synthetic lethal or synthetic rescue interactions.

  • Proximity-based proteomics: Use techniques like BioID to identify proteins in close proximity to BBta_0376 during normal function. Changes affecting these proximal proteins after BBta_0376 knockout are more likely to be direct consequences.

  • Suppressor screens: Identify mutations that suppress BBta_0376 knockout phenotypes. Suppressors often function in the same pathway or process, helping define the primary functional context of BBta_0376.

For septation proteins like BBta_0376, compare observed phenotypes with known septation defects in model organisms. Direct effects would typically include altered division site selection, aberrant septum formation, or mislocalization of other divisome components, while indirect effects might include broader impacts on cell shape, growth rate, or stress responses.

How might BBta_0376 function differ across various Bradyrhizobium species in the rhizosphere?

The function of BBta_0376 likely varies across Bradyrhizobium species in the rhizosphere due to evolutionary adaptations to specific ecological niches. Recent studies have identified at least 74 species of Bradyrhizobium with distinct distribution patterns in bulk soil and rhizosphere environments . This diversity suggests potential functional variations in core cellular processes, including septation mechanisms mediated by proteins like BBta_0376.

To investigate these differences methodically, researchers should implement comparative genomic analyses across Bradyrhizobium species, examining BBta_0376 sequence conservation, gene synteny, and potential horizontal gene transfer events. Particular attention should be paid to differences between predominant soil species (B. liaoningense, B. americanum, B. diversitatus) versus nodulating specialists (B. japonicum, B. elkanii, B. diazoefficiens) .

Functional characterization across species should include heterologous complementation experiments, expressing BBta_0376 orthologs from different species in a model strain with the native gene deleted to assess functional conservation. Variations in expression patterns should be examined using qRT-PCR or reporter fusions under different environmental conditions mimicking rhizosphere microenvironments (varying pH, oxygen levels, carbon sources).

The ecological significance of BBta_0376 variations could be assessed through competition experiments in rhizosphere environments, comparing growth and colonization efficiency of strains with native versus heterologous BBta_0376. These experiments should be performed using both laboratory microcosms and field trials to capture the full complexity of rhizosphere dynamics.

What are the implications of BBta_0376 research for understanding septation mechanisms in other alpha-proteobacteria?

Research on BBta_0376 has significant implications for understanding septation mechanisms across alpha-proteobacteria, potentially revealing conserved principles and lineage-specific adaptations. BBta_0376 belongs to the ispA/ispZ family of intracellular septation proteins , which appear to function in cell division processes. Comparative analysis of these proteins across alpha-proteobacteria could illuminate how core cell division machinery has evolved in this diverse bacterial class.

Experimental validation through heterologous complementation studies can determine functional exchangeability of septation proteins between species. For instance, researchers could test whether BBta_0376 from Bradyrhizobium can complement septation defects in related genera like Rhizobium, Sinorhizobium, or even distantly related alpha-proteobacteria like Caulobacter. Cell division phenotypes should be carefully characterized using advanced microscopy techniques to identify subtle variations in septum formation, constriction dynamics, and division site selection.

The broader implications extend to understanding how septation processes have adapted to different ecological niches and lifestyles across alpha-proteobacteria, from free-living soil bacteria to obligate intracellular pathogens. This knowledge could ultimately reveal potential targets for antimicrobial development or strategies for optimizing growth behaviors in biotechnologically relevant alpha-proteobacteria.

How can CRISPR-Cas9 technologies be optimized for studying BBta_0376 function in Bradyrhizobium?

Optimizing CRISPR-Cas9 technologies for studying BBta_0376 function in Bradyrhizobium requires addressing several challenges specific to this bacterial genus. Bradyrhizobium species often have high GC content, complex genomes, and can be recalcitrant to genetic manipulation. A methodological framework for CRISPR-Cas9 optimization should include:

  • Vector system adaptation: Modify existing CRISPR-Cas9 vectors for compatibility with Bradyrhizobium by selecting appropriate replication origins (e.g., broad-host-range origins like pBBR1) and antibiotic resistance markers effective in Bradyrhizobium (e.g., kanamycin, tetracycline). Consider developing integrative vectors for stable maintenance without selection pressure.

  • Promoter optimization: Replace standard promoters with those active in Bradyrhizobium for expressing Cas9 and guide RNAs. Options include native strong promoters like the constitutive nifH promoter or inducible systems like the vanillate-inducible system adapted for alpha-proteobacteria.

  • Guide RNA design considerations: Account for the high GC content of Bradyrhizobium genomes when designing gRNAs. Use specialized algorithms that consider GC content in scoring potential off-target effects. Target unique regions within BBta_0376 that lack similarity to other genomic regions to minimize off-target effects.

  • Delivery method optimization: Test various transformation techniques including electroporation, conjugation, and polyethylene glycol-mediated transformation to determine optimal delivery methods for CRISPR-Cas9 components. Conjugation from specialized E. coli donor strains often yields higher efficiency for Bradyrhizobium.

  • HDR template design: For precise editing of BBta_0376, design homology-directed repair (HDR) templates with extended homology arms (>500 bp) on each side of the target site to enhance recombination efficiency in Bradyrhizobium.

  • Screening and validation: Develop efficient screening methods combining PCR-based genotyping, phenotypic assays relevant to septation defects, and sequencing to identify successful edits. Consider implementing pooled screening approaches for higher throughput.

Implementing these optimizations will enable precise genetic manipulation of BBta_0376, facilitating functional studies through domain mutagenesis, protein tagging for localization studies, and promoter engineering for expression modulation.

What strategies can overcome expression difficulties when producing recombinant BBta_0376?

Overcoming expression difficulties for recombinant BBta_0376 requires a systematic troubleshooting approach addressing the unique challenges of membrane protein expression. The methodological workflow should begin with optimizing the expression construct itself. Design synthetic BBta_0376 genes with codon optimization matching the expression host's preference, avoiding rare codons that might limit translation efficiency. Consider incorporating purification tags at either terminus, but test both N-terminal and C-terminal placements, as membrane topology may render one position inaccessible.

For bacterial expression systems, systematically test temperature (16°C, 25°C, 30°C), induction conditions (IPTG concentration from 0.1-1.0 mM), and growth media (rich media like LB versus minimal media). Lower temperatures often improve membrane protein folding by slowing production rate. For difficult cases, consider specialized strains like C41(DE3), C43(DE3), or Lemo21(DE3) specifically engineered for membrane protein expression.

If bacterial expression proves challenging, explore alternative systems including:

  • Cell-free protein synthesis with supplied lipids or detergents

  • Insect cell expression using baculovirus vectors

  • Yeast systems like Pichia pastoris for eukaryotic expression environments

For proper folding, consider co-expression with chaperones like GroEL/ES that can assist membrane protein folding. Additionally, fusion partners such as maltose-binding protein (MBP) or thioredoxin may enhance solubility and expression levels.

For extraction and purification, screen multiple detergents systematically, testing representatives from different classes (maltoside, glucoside, and neopentyl glycol-based detergents) at varying concentrations. Implement small-scale expression tests with different constructs and conditions before scaling up to identify optimal parameters for BBta_0376 production.

How can researchers troubleshoot localization experiments for BBta_0376 in Bradyrhizobium cells?

Troubleshooting localization experiments for BBta_0376 in Bradyrhizobium cells requires systematic identification and resolution of common technical challenges. When fluorescent protein fusions fail to produce detectable signals, first verify protein expression through Western blotting, as low expression or protein degradation may cause signal issues. If the protein is expressed but not visible, optimize image acquisition parameters including exposure time, gain, and laser power based on positive controls with known subcellular localization patterns.

For non-specific or diffuse localization patterns, consider that fusion proteins may disrupt proper targeting. Test alternative linkers between BBta_0376 and the fluorescent tag, varying composition (Gly-Ser repeats or rigid linkers) and length (5-20 amino acids). Additionally, examine both N-terminal and C-terminal fusions, as BBta_0376's membrane topology may make one terminus inaccessible or disrupt function.

When background fluorescence interferes with visualization, implement specialized sample preparation techniques. Minimize media autofluorescence by washing cells thoroughly with non-fluorescent buffers before imaging. Consider spectral unmixing during image acquisition to separate specific signals from autofluorescence profiles.

The table below summarizes common localization problems and their solutions:

ProblemPossible CausesTroubleshooting Steps
No detectable signalLow expression, protein degradationVerify expression by Western blot, optimize promoter strength
Diffuse localizationFusion disrupts targeting, overexpressionTest alternative tag positions, reduce expression level
Punctate artifactsProtein aggregationOptimize expression conditions, test different fluorescent proteins
High backgroundMedia components, cellular autofluorescenceWash thoroughly, use low-fluorescence media, apply spectral unmixing
Inconsistent patternsCell cycle dependency, growth condition sensitivitySynchronize cultures, standardize growth conditions

For septation proteins like BBta_0376, implement time-lapse imaging to capture dynamic localization changes throughout the cell cycle, as static images may miss transient localization patterns during cell division events.

What controls are essential when analyzing the effects of BBta_0376 mutations on septation?

  • Genetic complementation controls: Beyond the mutant strain, always include:

    • Wild-type strain (positive control)

    • Mutant strain complemented with wild-type BBta_0376 (rescue control)

    • Mutant strain with empty vector (negative control)

    • Mutant strain complemented with site-directed mutants affecting specific domains (functional domain controls)

  • Growth condition controls:

    • Standardize media composition, temperature, and growth phase for all analyses

    • Test multiple conditions representing different environmental stresses to distinguish condition-specific phenotypes

    • Include time-course analyses to capture septation defects that may vary with growth phase

  • Microscopy-specific controls:

    • Use membrane stains (FM4-64) and DNA stains (DAPI) as reference markers for all strains

    • Include positive controls with known septation defects (when available) for phenotypic comparison

    • Implement blind analysis where microscopists evaluate images without knowing strain identities

  • Quantification controls:

    • Develop clear, reproducible criteria for classifying septation phenotypes

    • Count sufficient cells (>200 per condition) across multiple biological replicates

    • Apply appropriate statistical tests comparing mutant to wild-type and complemented strains

  • Molecular controls for protein expression:

    • Verify BBta_0376 expression levels in wild-type, mutant, and complemented strains by qRT-PCR and Western blotting

    • Assess potential polar effects on downstream genes in the operon

    • Monitor expression of other septation proteins to identify potential compensatory responses

By implementing these controls, researchers can confidently attribute observed septation phenotypes to BBta_0376 mutations rather than experimental artifacts, strain background differences, or secondary effects.

What are the most promising future directions for BBta_0376 research?

The most promising future directions for BBta_0376 research lie at the intersection of structural biology, systems-level analysis, and ecological studies. Advanced structural studies using cryo-electron microscopy should be prioritized to determine how BBta_0376 interacts with the bacterial membrane and other septation proteins. This structural information would provide a foundation for rational design of mutants targeting specific functional domains.

Integrative multi-omics approaches combining transcriptomics, proteomics, and metabolomics in both laboratory and field conditions will reveal how BBta_0376 function is regulated in response to environmental signals encountered in the rhizosphere. This systems-level understanding could explain the differential success of various Bradyrhizobium species in colonizing soil versus forming nodules .

Advanced imaging techniques such as super-resolution microscopy and single-molecule tracking should be applied to visualize BBta_0376 dynamics during cell division in real-time. These studies would reveal the precise timing of BBta_0376 recruitment to division sites and its interactions with other components of the septation machinery.

Comparative studies across the 74 identified Bradyrhizobium species could reveal evolutionary adaptations in septation mechanisms that contribute to ecological specialization. This work would have broader implications for understanding bacterial adaptation to specific environmental niches.

Finally, applied research exploring how BBta_0376 function affects Bradyrhizobium colonization efficiency and nitrogen fixation capacity could lead to strategies for enhancing beneficial plant-microbe interactions in agricultural settings.

How might findings from BBta_0376 research translate to applications in agriculture or biotechnology?

Findings from BBta_0376 research have significant potential to translate into applications in both agriculture and biotechnology through several pathways. In agriculture, understanding how BBta_0376 influences Bradyrhizobium cell division could lead to strategies for enhancing rhizosphere colonization and nodulation efficiency. Given that Bradyrhizobium species are critical nitrogen-fixing symbionts of soybeans , optimizing their growth and colonization capabilities could improve sustainable agriculture practices by reducing dependence on chemical fertilizers.

Detailed knowledge of BBta_0376's role in septation could enable the development of engineered Bradyrhizobium strains with enhanced colonization capabilities or tailored growth characteristics. For instance, strains with modified BBta_0376 activity might exhibit increased persistence in soil under stress conditions like drought or temperature fluctuations, extending their beneficial effects throughout the growing season.

In biotechnology applications, BBta_0376 could serve as a target for developing growth-regulating compounds specific to alpha-proteobacteria. Such compounds might find applications in controlling the growth of related pathogenic species while preserving beneficial rhizobial populations. Additionally, the regulatory mechanisms controlling BBta_0376 expression and activity could provide genetic elements for designing synthetic biology tools that respond to specific environmental cues.

If BBta_0376 proves essential for septation in Bradyrhizobium, it could also serve as a selectable marker for genetic engineering, particularly in applications requiring stable maintenance of introduced genetic material without antibiotic selection in field conditions. This would address biosafety concerns associated with the release of genetically modified microorganisms containing antibiotic resistance genes.

What methodological advances are needed to accelerate research on BBta_0376 and related septation proteins?

Accelerating research on BBta_0376 and related septation proteins requires methodological advances in several key areas. First, genetic manipulation tools for Bradyrhizobium need significant improvement. Despite recent advances in CRISPR-Cas9 technologies, application to Bradyrhizobium remains challenging due to its high GC content and relatively slow growth. Developing optimized CRISPR systems with efficient delivery methods and validated guide RNA design principles specific for Bradyrhizobium would dramatically accelerate functional genomics studies of BBta_0376.

Imaging technologies require advancement for studying septation dynamics in real-time. While current microscopy techniques can visualize protein localization, they often lack the temporal resolution to capture rapid protein movements during septation or the spatial resolution to distinguish closely associated proteins within the septation complex. Adapting super-resolution techniques like PALM, STORM, or expansion microscopy specifically for bacterial systems would provide crucial insights into BBta_0376 function.

Protein structure determination methods need adaptation for membrane proteins like BBta_0376. Despite advances in cryo-electron microscopy, solving structures of smaller membrane proteins (<30 kDa) remains challenging. Developing specialized approaches combining computational prediction with experimental validation through methods like EPR spectroscopy or crosslinking mass spectrometry could overcome these limitations.

Finally, developing high-throughput phenotyping methods to analyze septation defects would enable larger-scale genetic screens and comparative studies across Bradyrhizobium species. Automated image analysis workflows using machine learning algorithms could quantify subtle changes in cell morphology, division site placement, and septation timing, allowing researchers to process thousands of images with consistent criteria and minimal bias.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.