Form
Lyophilized powder
Please note that we prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes. We will do our best to accommodate your request.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributors for specific delivery estimates.
All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type in mind, please inform us. We will prioritize developing the specified tag if feasible.
Synonyms
yciB; BRADO0387; Inner membrane-spanning protein YciB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Protein Length
full length protein
Species
Bradyrhizobium sp. (strain ORS 278)
Target Protein Sequence
MDKTQPHPLFKLATELGPLIVFFFVNAKFNLFAATGAFMVAIIAALIASYVVTRHIPLMA
LVTAVVVIVFGTLTLVLHDETFIKVKPTIIYGLFAAVLGGGLVFNRSFIAIMFDQMFNLT
PAGWRILTFRWALFFAGMAVLNEIIWRTQSTDFWVGFKAFGVLPLTMIFAIAQMPLIKRY
HQDPASLEASDAAEGDVSKG