Recombinant Bradyrhizobium sp. Undecaprenyl-diphosphatase (uppP)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline for your preparations.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
uppP; BRADO0129; Undecaprenyl-diphosphatase; Bacitracin resistance protein; Undecaprenyl pyrophosphate phosphatase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-268
Protein Length
full length protein
Species
Bradyrhizobium sp. (strain ORS 278)
Target Names
uppP
Target Protein Sequence
MMSDTLRAVLLGIVEGVTEFLPVSSTGHLLLAERFFGLGEDGFWKSFAILIQLGAILAIV ALYFFKLSRVAIGALTNPDDRRFIIGVLIAFLPAVIIGLIAGKYIKALLFDPWVVCFSLI VGGAILLWVDQIDLKPREHDATRYPLMMYLWIGVAQCLAMIPGVSRSGSTIVAAMLLGGD KRSAAEFSFFLAIPTMVGAFVYDFYKSRAEMTSDHLGLIAIGFVVSFITAMIVVKAFLGY VTRHGFVLFAWWRVIVGTLGLIALALGK
Uniprot No.

Target Background

Function
Catalyzes the dephosphorylation of undecaprenyl diphosphate (UPP) and confers resistance to bacitracin.
Database Links
Protein Families
UppP family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Undecaprenyl-diphosphatase (uppP) and what is its primary function in Bradyrhizobium sp.?

Undecaprenyl-diphosphatase (uppP), also known as Bacitracin resistance protein or Undecaprenyl pyrophosphate phosphatase (EC 3.6.1.27), is an enzyme involved in bacterial cell wall biosynthesis. In Bradyrhizobium sp., this enzyme catalyzes the dephosphorylation of undecaprenyl pyrophosphate, which is essential for peptidoglycan synthesis . The enzyme plays a critical role in recycling the lipid carrier that transports peptidoglycan precursors across the cytoplasmic membrane, facilitating cell wall formation and maintenance .

How does uppP differ from Undecaprenyl pyrophosphate synthase (UppS) in bacterial systems?

While both enzymes are involved in cell wall biosynthesis pathways, they catalyze different reactions:

CharacteristicUndecaprenyl-diphosphatase (uppP)Undecaprenyl pyrophosphate synthase (UppS)
Catalytic functionDephosphorylates undecaprenyl pyrophosphateCatalyzes formation of C55 lipid carrier (UPP)
Position in pathwayRecycling phase of lipid carrierSynthesis phase of lipid carrier
Role in antibiotic resistanceDirect role in bacitracin resistanceReduction can lead to vancomycin resistance
UniProt ID (Bradyrhizobium sp.)A5E8M5Different accession number

UppS catalyzes an earlier step in the pathway, synthesizing the lipid carrier that uppP later dephosphorylates. Notably, studies have shown that mutations affecting UppS levels can alter bacterial susceptibility patterns to cell wall-active antibiotics such as vancomycin, fosfomycin, and d-cycloserine .

What are the optimal conditions for expressing recombinant Bradyrhizobium sp. uppP in laboratory settings?

For optimal expression of recombinant Bradyrhizobium sp. uppP, researchers should consider the following parameters:

  • Expression system: E. coli BL21(DE3) or similar expression strains are commonly used for recombinant membrane protein expression.

  • Vector selection: Vectors containing T7 promoters with appropriate tags for purification (His-tag is commonly used).

  • Temperature: Lower temperatures (16-25°C) often yield better results for membrane proteins compared to standard 37°C.

  • Induction conditions: 0.1-0.5 mM IPTG is typically used, with induction at lower optical densities (OD600 ~0.6).

  • Growth media: Rich media supplemented with glucose can help stabilize recombinant protein expression.

After expression, the protein should be stored in a Tris-based buffer with 50% glycerol at -20°C for short-term storage or -80°C for extended storage. Repeated freeze-thaw cycles should be avoided, and working aliquots can be stored at 4°C for up to one week .

How can researchers design experimental controls when studying the enzymatic activity of recombinant uppP?

When designing experiments to study uppP enzymatic activity, implement the following controls:

  • Negative controls:

    • Heat-inactivated uppP (95°C for 10 minutes)

    • Reaction mixture without enzyme

    • Reaction with purification tag alone (if tag was not cleaved)

  • Positive controls:

    • Commercial phosphatase with known activity

    • Previously validated uppP batch with confirmed activity

  • Specificity controls:

    • Testing alternative substrates (non-undecaprenyl phosphates)

    • Including specific phosphatase inhibitors

  • System validation:

    • Kinetic analysis with varying substrate concentrations

    • pH and temperature optimization curves

What assays are most effective for measuring the phosphatase activity of uppP?

Several assay methods can be employed to measure uppP phosphatase activity:

Assay TypePrincipleAdvantagesLimitations
Malachite Green AssayColorimetric detection of released phosphateHigh sensitivity, simple equipmentPotential interference from buffers
Enzyme-Coupled AssayCoupling phosphate release to NADH oxidationContinuous monitoringMultiple enzymes increase complexity
Radiolabeled Substrate AssayUsing 32P-labeled substratesHigh sensitivity and specificityRequires radioactive materials handling
HPLC-based AssayDirect quantification of substrate/productDirect measurement, high specificityRequires specialized equipment
Fluorescence-based AssayFluorogenic substrate conversionHigh sensitivity, real-time monitoringLimited substrate availability

The malachite green assay is often preferred for initial characterization due to its accessibility, while HPLC-based methods provide more definitive results for detailed kinetic analyses and substrate specificity studies.

How does uppP contribute to antibiotic resistance mechanisms in bacteria?

Undecaprenyl-diphosphatase (uppP) plays a significant role in bacterial antibiotic resistance through several mechanisms:

  • Bacitracin resistance: uppP directly counteracts bacitracin's mechanism of action by recycling undecaprenyl pyrophosphate, preventing its sequestration by the antibiotic.

  • Cell wall integrity maintenance: By ensuring efficient recycling of the lipid carrier, uppP helps maintain peptidoglycan synthesis even under antibiotic stress.

  • Complementary resistance mechanisms: Similar to the functions observed with UppS mutations, uppP activity may modulate susceptibility to various cell wall-targeting antibiotics. Research has shown that alterations in the related UppS pathway can increase resistance to vancomycin, fosfomycin, and d-cycloserine .

  • Stress response coordination: The enzyme's activity may be coordinated with other cellular stress responses, potentially contributing to adaptive resistance mechanisms.

Understanding uppP's role in resistance is crucial for developing strategies to overcome bacterial antibiotic resistance.

What is the relationship between uppP activity and bacterial cell wall synthesis in Bradyrhizobium sp.?

The relationship between uppP activity and cell wall synthesis in Bradyrhizobium sp. involves several interdependent processes:

  • Lipid carrier recycling: uppP dephosphorylates undecaprenyl pyrophosphate to undecaprenyl phosphate, which is then further processed to regenerate the lipid carrier undecaprenol.

  • Peptidoglycan synthesis cycle: This recycling step is essential for maintaining sufficient carrier molecules for transporting peptidoglycan precursors.

  • Membrane integrity: Proper uppP function ensures balanced phospholipid composition in the bacterial membrane.

  • Growth phase coordination: uppP activity likely fluctuates with growth phases, with heightened activity during active cell division.

While not specifically studied in Bradyrhizobium sp., research on related bacterial systems suggests that disruptions in uppP function can lead to morphological abnormalities, altered cell division, and increased susceptibility to environmental stressors .

How does uppP function differ between Bradyrhizobium sp. and other bacterial species?

Comparative analysis of uppP across bacterial species reveals several differences:

Bacterial SpeciesuppP CharacteristicsFunctional Implications
Bradyrhizobium sp.Contains distinctive transmembrane regions; specific amino acid sequenceMay reflect adaptation to endophytic lifestyle; potential host-specific interactions
E. coliWell-characterized BacA protein; multiple paralogs (YbjG, PgpB, LpxT)Redundancy provides robust resistance to bacitracin
B. subtilisSingle uppP protein (BcrC); regulated by σMStress-responsive expression pattern; linked to broader cell envelope stress response
MycobacteriaModified structure adapted to unique cell wallFunctions within complex mycolic acid-containing cell envelope

The specific attributes of Bradyrhizobium sp. uppP may reflect adaptations to its endophytic lifestyle, particularly its ability to establish symbiotic relationships with various plant hosts. Research indicates that Bradyrhizobium strains can alter their cellular characteristics in response to plant-derived compounds, suggesting that uppP may function within a broader adaptive response system .

How can researchers investigate the role of uppP in Bradyrhizobium-plant symbiotic relationships?

To investigate uppP's role in symbiotic relationships, researchers should consider these methodological approaches:

  • Gene knockout/knockdown studies:

    • Create uppP-deficient mutants using CRISPR-Cas9 or transposon mutagenesis

    • Compare plant colonization efficiency between wild-type and mutant strains

    • Assess nitrogen fixation capacity in colonized plants

  • Transcriptomic analyses:

    • Compare uppP expression levels in free-living bacteria versus endophytic state

    • Analyze co-expression patterns with other symbiosis-related genes

    • Examine expression changes in response to plant extracts from different hosts

  • Plant interaction experiments:

    • Expose Bradyrhizobium to plant extracts and monitor uppP expression changes

    • Assess bacterial morphological changes (similar to those observed in SUTN9-2 strain)

    • Quantify bacterial survival in presence of plant-derived antimicrobial compounds

  • Biochemical approaches:

    • Test uppP activity in presence of plant-derived molecules

    • Investigate potential post-translational modifications during symbiosis

Recent research shows that Bradyrhizobium sp. strain SUTN9-2 undergoes significant physiological changes including cell enlargement and increased DNA content when exposed to plant extracts, with differential responses to different plant hosts . Similar mechanisms may involve uppP activity during host colonization.

What advanced techniques can be used to study the structure-function relationship of uppP?

Several cutting-edge techniques can elucidate uppP structure-function relationships:

  • Cryo-electron microscopy (Cryo-EM):

    • Achieves near-atomic resolution of membrane proteins in native-like environments

    • Can reveal conformational changes during catalytic cycle

    • Minimal sample preparation preserves structural integrity

  • X-ray crystallography with lipidic cubic phase:

    • Accommodates membrane proteins in lipid-like environment

    • Provides high-resolution structural data

    • Allows visualization of substrate binding sites

  • Molecular dynamics simulations:

    • Models protein behavior in membrane environment

    • Predicts conformational changes during substrate binding

    • Identifies potential allosteric regulation sites

  • Site-directed mutagenesis coupled with activity assays:

    • Systematically alters key residues to map functional domains

    • Correlates sequence variations with catalytic efficiency

    • Identifies essential amino acids for substrate recognition

  • Hydrogen-deuterium exchange mass spectrometry:

    • Maps protein dynamics and solvent accessibility

    • Identifies regions that undergo conformational changes

    • Works with membrane proteins in detergent micelles

These approaches can reveal how uppP's structure relates to its function in bacterial cell wall synthesis and antibiotic resistance mechanisms.

How can researchers address contradictory data when studying uppP enzymatic mechanisms?

When confronting contradictory data in uppP research, implement these methodological steps:

  • Thorough data examination:

    • Identify specific discrepancies between expected and observed results

    • Analyze outliers that may influence interpretations

    • Compare findings with existing literature on related phosphatases

  • Evaluate initial assumptions:

    • Reassess the proposed enzymatic mechanism

    • Review substrate purity and potential contaminating activities

    • Consider alternative catalytic models

  • Refine experimental controls:

    • Implement additional positive and negative controls

    • Test for interfering factors in reaction conditions

    • Consider batch-to-batch variation in protein preparations

  • Modify data collection:

    • Employ orthogonal assay methods to verify findings

    • Increase technical and biological replicates

    • Adjust time points for enzyme kinetics studies

  • Consider alternative hypotheses:

    • Evaluate potential allosteric regulation

    • Investigate post-translational modifications

    • Assess oligomerization states affecting activity

As noted in research methodology literature, contradictory data often leads to new discoveries when properly analyzed, and researchers should approach unexpected results as opportunities rather than failures .

What are the implications of uppP research for developing new antimicrobial strategies?

Research on Bradyrhizobium sp. uppP has significant implications for novel antimicrobial development:

  • Direct enzyme inhibition:

    • Design of specific uppP inhibitors could synergize with existing antibiotics

    • Structure-based drug design targeting the active site

    • Allosteric inhibitors disrupting necessary conformational changes

  • Combination therapy approaches:

    • Pairing uppP inhibitors with bacitracin for enhanced efficacy

    • Targeting multiple steps in peptidoglycan synthesis pathway

    • Counteracting resistance mechanisms

  • Cross-species applications:

    • Knowledge from Bradyrhizobium sp. uppP can inform strategies against pathogenic bacteria

    • Comparative analysis with pathogen enzymes reveals conserved targetable features

    • Species-specific inhibitor development

  • Agricultural applications:

    • Modulating Bradyrhizobium-plant interactions for improved crop yields

    • Engineering beneficial strains with optimized uppP activity

    • Developing biological controls for plant pathogens

Understanding the mechanisms of uppP in Bradyrhizobium sp. provides insights applicable to both medical and agricultural antimicrobial development strategies. The enzyme's role in antibiotic resistance and bacterial adaptation to plant hosts makes it a valuable target for interdisciplinary research.

What are the optimal storage and handling conditions for maintaining recombinant uppP activity?

To maintain optimal activity of recombinant Bradyrhizobium sp. uppP, follow these research-validated protocols:

  • Storage conditions:

    • Store at -20°C for routine use

    • Use -80°C for long-term storage

    • Maintain in Tris-based buffer with 50% glycerol

    • Optimize buffer pH (typically 7.5-8.0) and salt concentration for stability

  • Handling recommendations:

    • Avoid repeated freeze-thaw cycles (create single-use aliquots)

    • Keep working aliquots at 4°C for maximum of one week

    • Use low-binding microcentrifuge tubes to prevent protein adsorption

    • Add reducing agents (e.g., DTT or β-mercaptoethanol) if disulfide formation is possible

  • Activity preservation:

    • Include appropriate detergents for membrane protein stability

    • Consider adding protease inhibitors during handling

    • Maintain proper ionic strength in working solutions

    • Pre-warm buffers to room temperature before use

Following these guidelines will help maintain enzyme activity and ensure reproducible experimental results .

How can researchers troubleshoot common issues in recombinant uppP expression and purification?

When troubleshooting recombinant uppP expression and purification, address these common challenges:

IssuePotential CausesResolution Strategies
Low expression yieldToxicity to host cells; Codon bias; Protein instabilityUse tightly controlled induction systems; Optimize codon usage; Lower expression temperature; Co-express chaperones
Inclusion body formationOverexpression; Improper folding; Hydrophobic protein natureReduce induction level; Lower temperature; Use solubilizing tags; Consider refolding protocols
Poor solubilityMembrane protein character; Improper detergent selectionScreen different detergents; Use mild solubilization conditions; Consider nanodisc or amphipol systems
Loss of activity during purificationDetergent effects; Removal of essential cofactors; OxidationTest detergent exchange; Supplement with potential cofactors; Include reducing agents
Aggregation during storageProtein concentration too high; Buffer incompatibility; Freeze-thaw damageOptimize protein concentration; Screen stabilizing additives; Prepare single-use aliquots

For membrane proteins like uppP, detergent selection is particularly critical. Begin with milder detergents (DDM, LMNG) and optimize conditions systematically while monitoring activity.

What experimental design approaches are most effective for studying uppP inhibitors?

When designing experiments to identify and characterize uppP inhibitors, implement these methodological approaches:

  • Initial screening design:

    • Develop a medium-throughput phosphatase assay amenable to inhibitor screening

    • Include positive controls (known phosphatase inhibitors)

    • Establish Z-factor for assay quality control

    • Screen compounds at multiple concentrations (dose-response curves)

  • Validation experiments:

    • Confirm hits with orthogonal assay methods

    • Test for non-specific inhibition (detergent-sensitive aggregators)

    • Evaluate inhibition mechanism (competitive, non-competitive, uncompetitive)

    • Determine IC50 and Ki values

  • Specificity assessment:

    • Test against related phosphatases

    • Evaluate effects on bacterial growth

    • Assess cytotoxicity against mammalian cells

    • Examine structure-activity relationships

  • Mechanism studies:

    • Use enzyme kinetics to determine inhibition type

    • Perform binding studies (ITC, SPR, MST)

    • Consider structural studies with bound inhibitors

    • Evaluate resistance development potential

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.