Recombinant Bradyrhizobium sp. UPF0059 membrane protein BBta_7389 (BBta_7389)

Shipped with Ice Packs
In Stock

Description

Functional Role

BBta_7389 is implicated in manganese (Mn²⁺) and magnesium (Mg²⁺) homeostasis, critical for bacterial survival under oxidative stress . Key findings include:

  • Metal Ion Transport: Functions as a Mn²⁺ efflux pump, mitigating metal toxicity in Bradyrhizobium during symbiotic nitrogen fixation .

  • Stress Response: Linked to resistance against methyl viologen (paraquat) and hydrogen peroxide (H₂O₂), suggesting a role in oxidative stress management .

  • Symbiotic Relevance: While not directly part of the nitrogenase complex, its metal-regulatory function may indirectly support rhizobial persistence in legume root nodules .

Research Applications

BBta_7389 is commercially available as a recombinant protein for biochemical studies . Applications include:

  • Mechanistic Studies: Investigating metal transport kinetics and membrane protein dynamics.

  • Antibody Production: Used as an antigen for generating antibodies targeting Mn²⁺ transporters .

  • Comparative Genomics: Serves as a marker for analyzing genetic adaptations in Bradyrhizobium variants under environmental stress .

Genomic and Evolutionary Context

  • Gene Localization: Located outside the symbiosis island in Bradyrhizobium sp. BTAi1, suggesting its role is not directly tied to nodulation but to general stress adaptation .

  • Conservation: Orthologs of mntP exist in Klebsiella, Pantoea, and other rhizobia, highlighting evolutionary conservation in metal homeostasis .

Limitations and Future Directions

  • Structural Data: No 3D structure is available in the PDB, necessitating crystallography or cryo-EM studies .

  • In Vivo Validation: Functional assays in plant-microbe systems are needed to confirm its role in symbiosis .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference in the order notes. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery details.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipment, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein with deionized sterile water to a concentration of 0.1-1.0 mg/mL. To enhance long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution for storage at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, liquid formulations have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms typically exhibit a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple use, aliquotting is recommended. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag type, please inform us and we will prioritize the development of your specified tag.
Synonyms
mntP; BBta_7389; Putative manganese efflux pump MntP
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-185
Protein Length
full length protein
Species
Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182)
Target Names
mntP
Target Protein Sequence
MSPFAVVLLAFSMSVDAFAVSVGRGAALGRPRYSEALRSGAVFGVVEAITPVIGWVAGVA ASSFVQAVDHWLAFGLLAAVGLHMLYAAVWKKADAKPVGRSFTVLMATAIGTSLDAMAVG VSLAFLNVNIVVVATAIGLATFLMSSGGMLIGRLIGEHFGRIAEAVAGIALFGLGLSILI EHLTA
Uniprot No.

Target Background

Function
This protein is likely involved in manganese efflux as a pump.
Database Links
Protein Families
MntP (TC 9.B.29) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

How should Recombinant BBta_7389 protein be stored and reconstituted?

For optimal stability and activity, Recombinant BBta_7389 protein should be stored as follows:

  • Long-term storage: Store the lyophilized powder at -20°C to -80°C.

  • Reconstitution protocol:

    • Briefly centrifuge the vial before opening

    • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • Add glycerol to a final concentration of 5-50% (50% is recommended)

    • Aliquot for long-term storage at -20°C/-80°C

  • Working stock storage: Store working aliquots at 4°C for up to one week

  • Storage buffer: Tris/PBS-based buffer with 6% Trehalose, pH 8.0

  • Stability considerations: Avoid repeated freeze-thaw cycles as this can compromise protein integrity and activity

What experimental approaches can be used to verify BBta_7389 protein function?

To verify the function of BBta_7389 as a putative manganese efflux pump, several complementary experimental approaches can be employed:

  • Metal transport assays:

    • Use radioactive manganese (⁵⁴Mn) uptake/efflux assays in cells expressing BBta_7389

    • Measure intracellular manganese concentrations using inductively coupled plasma mass spectrometry (ICP-MS)

    • Compare manganese levels in cells with and without BBta_7389 expression

  • Growth phenotype analysis:

    • Culture bacteria expressing BBta_7389 in media with varying manganese concentrations

    • Assess growth curves in manganese-replete vs. manganese-limited conditions

    • Compare with knockout strains lacking BBta_7389

  • Protein-metal interaction studies:

    • Isothermal titration calorimetry (ITC) to measure binding affinity with manganese

    • Fluorescence spectroscopy with metal-sensitive fluorophores

    • Circular dichroism (CD) to detect conformational changes upon metal binding

  • Functional complementation:

    • Express BBta_7389 in bacterial strains with deletions of known manganese transporters

    • Assess whether BBta_7389 can restore wild-type phenotypes

These approaches should be implemented using properly designed experimental protocols with appropriate controls to validate the protein's function .

How can I design experiments to characterize the membrane topology of BBta_7389?

Characterizing the membrane topology of BBta_7389 requires a multi-faceted experimental approach:

  • Computational prediction and analysis:

    • Begin with in silico transmembrane domain prediction using algorithms such as TMHMM, Phobius, or MEMSAT

    • Based on the amino acid sequence, BBta_7389 likely contains multiple transmembrane domains arranged in a helical bundle conformation

  • Biochemical mapping techniques:

    • Cysteine scanning mutagenesis: Replace individual residues with cysteine throughout the protein and assess accessibility to membrane-impermeable sulfhydryl reagents

    • Protease protection assays: Treat membrane vesicles with proteases to identify protected (intramembrane) vs. accessible (extramembrane) domains

    • Glycosylation mapping: Insert glycosylation sites throughout the protein sequence; only sites in the periplasm will be glycosylated

  • Structural biology approaches:

    • Cryo-electron microscopy: For high-resolution structural determination

    • X-ray crystallography: If protein crystals can be obtained

    • Nuclear magnetic resonance (NMR): For structural determination of specific domains

  • Fluorescence-based techniques:

    • FRET (Förster resonance energy transfer): To measure distances between domains

    • GFP-fusion analysis: Create fusion proteins with GFP at various positions to determine orientation

The experimental design should include systematic controls and replicate measurements to ensure reliability of the topology model. Based on similar membrane proteins, BBta_7389 likely adopts a structure with transmembrane domains forming a pore or channel that facilitates manganese transport across the bacterial membrane .

What are the optimal conditions for expressing soluble and functional BBta_7389 in heterologous systems?

Optimizing expression of membrane proteins like BBta_7389 requires careful consideration of expression systems and conditions:

Table 1: Optimization Parameters for BBta_7389 Expression

ParameterRecommended ConditionsRationale
Expression SystemE. coli BL21(DE3), C41(DE3), or C43(DE3)Specialized strains for membrane protein expression
Induction Temperature16-20°CLower temperatures reduce aggregation
Inducer Concentration0.1-0.5 mM IPTGLower concentrations promote proper folding
Growth MediaTB or 2XYT supplemented with 1% glucoseRicher media support membrane protein synthesis
Expression Time16-20 hoursExtended time for proper folding and insertion
Membrane FractionInner membraneBBta_7389 naturally localizes to inner membrane
Detergents for ExtractionDDM (n-Dodecyl-β-D-maltoside), LMNG, or LDAOMild detergents preserve function
Stabilizing Additives10% glycerol, 100-500 mM NaClEnhance stability during purification

Methodological steps for optimized expression:

  • Construct design considerations:

    • Include the full-length protein (1-185 amino acids)

    • Incorporate an N-terminal His-tag with an optional TEV protease cleavage site

    • Consider codon optimization for the expression host

  • Pilot expression tests:

    • Test multiple strains, temperatures, and induction conditions in small-scale cultures

    • Analyze expression by Western blotting and activity assays

    • Select conditions that yield the highest proportion of properly folded protein

  • Scale-up and purification:

    • Use tangential flow filtration for efficient cell harvesting

    • Employ gentle lysis methods (e.g., enzymatic lysis with lysozyme)

    • Solubilize membrane fractions with selected detergents

    • Purify using immobilized metal affinity chromatography (IMAC)

    • Consider additional purification steps such as size exclusion chromatography

  • Functional validation:

    • Assess protein folding by circular dichroism

    • Verify manganese transport activity in proteoliposomes

    • Test stability in different buffer compositions

Through systematic optimization of these parameters, researchers can obtain functional BBta_7389 suitable for downstream biochemical and structural studies .

How can I establish an in vitro assay system to measure the manganese transport activity of BBta_7389?

Developing a robust in vitro assay for BBta_7389 manganese transport activity requires careful experimental design:

  • Proteoliposome reconstitution:

    • Prepare liposomes using E. coli polar lipid extract (70%) and phosphatidylcholine (30%)

    • Incorporate purified BBta_7389 at a protein:lipid ratio of 1:100 to 1:200

    • Use detergent removal methods (e.g., Bio-Beads, dialysis) to form proteoliposomes

    • Include parallel preparations without BBta_7389 as negative controls

  • Transport assay design:

    • Direct metal measurement approach:

      • Load proteoliposomes with defined concentrations of MnCl₂

      • Initiate transport by establishing a concentration gradient

      • Monitor Mn²⁺ efflux using inductively coupled plasma mass spectrometry (ICP-MS)

      • Calculate transport rates based on time-course measurements

    • Fluorescence-based approach:

      • Load proteoliposomes with a manganese-sensitive fluorophore (e.g., Fura-2)

      • Monitor fluorescence changes in real-time upon addition of external Mn²⁺

      • Calibrate the system using ionophores to establish maximum signal

  • Kinetic characterization:

    • Determine Kₘ and Vₘₐₓ values by varying Mn²⁺ concentrations

    • Assess inhibition by other divalent cations (Ca²⁺, Mg²⁺, Fe²⁺, Zn²⁺)

    • Measure pH dependence of transport activity

    • Evaluate energy requirements (ATP-dependent or independent)

  • Validation controls:

    • Use ionophores (e.g., A23187) as positive controls for metal transport

    • Include proteoliposomes with inactive BBta_7389 mutants

    • Test transport specificity using other transition metals

    • Apply transport inhibitors to confirm specific activity

Expected results interpretation:
If BBta_7389 functions as a manganese efflux pump, proteoliposomes containing the protein should show significantly higher rates of Mn²⁺ efflux compared to protein-free liposomes. The transport activity should display saturation kinetics with respect to Mn²⁺ concentration, and may show specificity when compared with other divalent cations .

What approaches can be used to identify potential interaction partners of BBta_7389 in Bradyrhizobium?

Identifying interaction partners of membrane proteins like BBta_7389 requires specialized techniques:

  • Affinity-based approaches:

    • Pull-down assays: Express His-tagged BBta_7389 in Bradyrhizobium or E. coli, solubilize membranes with mild detergents, and identify co-purifying proteins by mass spectrometry

    • Co-immunoprecipitation: Use specific antibodies against BBta_7389 to precipitate the protein complex from solubilized membranes

    • Tandem affinity purification (TAP): Engineer BBta_7389 with dual tags for sequential purification steps to reduce non-specific binding

  • Proximity-based methods:

    • BioID or TurboID: Fuse BBta_7389 to a biotin ligase that biotinylates nearby proteins, which can then be purified and identified

    • APEX2 proximity labeling: Fuse BBta_7389 to an engineered peroxidase that labels proximal proteins with biotin-phenol

    • Chemical cross-linking followed by mass spectrometry: Use membrane-permeable cross-linkers to capture transient interactions

  • Genetic and functional screening:

    • Bacterial two-hybrid assays: Adapted for membrane proteins to identify direct interactions

    • Suppressor screens: Identify mutations that suppress BBta_7389 knockout phenotypes

    • Synthetic lethality screens: Identify genes that become essential in BBta_7389 mutant backgrounds

  • In silico approaches to guide experimental design:

    • Genomic context analysis: Identify genes co-localized with BBta_7389 in the Bradyrhizobium genome

    • Co-expression analysis: Identify genes with similar expression patterns

    • Structural modeling: Predict potential interaction surfaces

Experimental workflow for pull-down assays with LC-MS/MS analysis:

  • Express His-tagged BBta_7389 in Bradyrhizobium sp. or heterologous host

  • Prepare membrane fractions and solubilize with mild detergents (DDM, LMNG)

  • Perform affinity purification using Ni-NTA resin

  • Process samples for LC-MS/MS analysis

  • Use quantitative proteomics to compare BBta_7389 pull-downs with control samples

  • Filter hits based on enrichment ratios and statistical significance

  • Validate top candidates through reciprocal pull-downs and functional assays

This multi-faceted approach should yield a network of potential interaction partners that can be further characterized to understand the functional context of BBta_7389 in manganese homeostasis .

How can I design a robust experimental system to study the role of BBta_7389 in manganese homeostasis?

A comprehensive approach to studying BBta_7389's role in manganese homeostasis requires carefully designed experiments:

  • Genetic manipulation strategies:

    • Gene deletion: Create a clean BBta_7389 knockout in Bradyrhizobium using homologous recombination or CRISPR-Cas9

    • Controlled expression: Develop inducible expression systems to titrate BBta_7389 levels

    • Point mutations: Generate variants with substitutions in predicted metal-binding residues

    • Reporter fusions: Create transcriptional/translational fusions to monitor expression patterns

  • Phenotypic characterization:

    • Metal sensitivity assays: Compare growth of wild-type and mutant strains across a range of manganese concentrations (1 μM to 1 mM)

    • Intracellular metal quantification: Measure manganese content using ICP-MS

    • Transcriptional profiling: Analyze global gene expression changes in response to BBta_7389 manipulation

    • Symbiotic performance: Assess nodulation efficiency and nitrogen fixation in plant association experiments

  • Experimental design considerations:

    • Use factorial designs to efficiently test multiple variables

    • Include appropriate biological and technical replicates (minimum n=3)

    • Implement robust statistical analysis (ANOVA with post-hoc tests)

    • Control for confounding variables (growth phase, media composition)

Table 2: Experimental Design for Metal Sensitivity Analysis

Experimental GroupGenotype[Mn²⁺] RangeMeasurementsTime Points
ControlWild-type0, 0.1, 1, 10, 100, 1000 μMGrowth (OD₆₀₀), Metal content, Gene expression0, 4, 8, 12, 24, 48h
Test 1ΔBBta_73890, 0.1, 1, 10, 100, 1000 μMGrowth (OD₆₀₀), Metal content, Gene expression0, 4, 8, 12, 24, 48h
Test 2BBta_7389 overexpression0, 0.1, 1, 10, 100, 1000 μMGrowth (OD₆₀₀), Metal content, Gene expression0, 4, 8, 12, 24, 48h
Test 3BBta_7389 site-directed mutants0, 0.1, 1, 10, 100, 1000 μMGrowth (OD₆₀₀), Metal content, Gene expression0, 4, 8, 12, 24, 48h
  • Data integration and interpretation:

    • Correlate BBta_7389 expression levels with manganese content

    • Map the regulatory network controlling BBta_7389 expression

    • Develop mathematical models of manganese homeostasis incorporating BBta_7389 function

    • Compare results with known manganese transporters in other bacterial species

This systematic approach will provide comprehensive insights into BBta_7389's role in manganese homeostasis, potentially revealing new aspects of metal transport mechanisms in bacteria .

What controls should be included when studying BBta_7389 protein-protein interactions?

Robust protein-protein interaction studies for BBta_7389 require careful implementation of multiple controls:

  • Negative controls for non-specific binding:

    • Empty vector or unrelated membrane protein expressed with the same tag

    • Untransfected/uninduced cells processed identically

    • Non-specific antibodies for immunoprecipitation studies

    • Beads-only control without bait protein

    • Pre-clearing lysates to remove naturally sticky proteins

  • Positive controls for assay validation:

    • Known membrane protein complexes processed in parallel

    • Artificial constructs with forced interactions (e.g., leucine zipper domains)

    • Internal complex within the same pathway (if known)

  • Specificity controls:

    • Competition with excess untagged protein

    • Mutant variants of BBta_7389 with altered interaction surfaces

    • Dose-dependent interaction analysis

    • Reciprocal tagging and pull-down of putative partners

  • Technical validation controls:

    • Input samples to verify starting material composition

    • Immunoblotting to confirm identity of interacting proteins

    • Multiple biological replicates (minimum n=3)

    • Different detergent conditions to validate membrane protein interactions

Structured experimental workflow with controls:

  • Express His-tagged BBta_7389 and control proteins (negative control: unrelated membrane protein with His-tag; positive control: known interacting membrane protein pair)

  • Prepare membrane fractions and solubilize with 1% DDM, 1% digitonin, and 1% LMNG in parallel

  • Perform affinity purification using standardized conditions

  • Split samples for immunoblotting validation and mass spectrometry analysis

  • Apply stringent filtering criteria:

    • 2-fold enrichment over negative controls

    • Present in multiple biological replicates

    • Consistent across different detergent conditions

    • Absent in beads-only controls

  • Validate top candidates through reverse pull-downs and functional assays

By implementing this comprehensive control strategy, researchers can differentiate genuine BBta_7389 interaction partners from background contaminants and non-specific binders .

How can I design a study to investigate the regulation of BBta_7389 expression in response to varying manganese levels?

To investigate how BBta_7389 expression responds to manganese levels, a multi-faceted approach is required:

  • Promoter analysis and reporter systems:

    • Transcriptional fusions: Clone the BBta_7389 promoter region upstream of reporter genes (GFP, luciferase, lacZ)

    • Translational fusions: Create in-frame fusions of BBta_7389 with reporters to capture both transcriptional and post-transcriptional regulation

    • Promoter dissection: Create a series of deletions and mutations in the promoter region to identify regulatory elements

  • Experimental design for metal-dependent regulation:

    • Metal gradient experiments: Subject bacteria to precisely controlled manganese concentrations (0-1000 μM)

    • Metal specificity: Test other divalent cations (Fe²⁺, Zn²⁺, Cu²⁺, Ni²⁺) to determine regulation specificity

    • Kinetics of response: Measure expression changes over time (0-24h) after metal addition/depletion

    • Cross-talk analysis: Combine manganese with other metals to identify interaction effects

Table 3: Experimental Conditions for BBta_7389 Regulation Study

Condition GroupMn²⁺ ConcentrationOther MetalsMeasurementsTime Points
Depletion0 μM (+ chelator)NoneReporter activity, mRNA levels, Protein levels0, 0.5, 1, 2, 4, 8, 24h
Low0.1, 1.0 μMNoneReporter activity, mRNA levels, Protein levels0, 0.5, 1, 2, 4, 8, 24h
Physiological5, 10 μMNoneReporter activity, mRNA levels, Protein levels0, 0.5, 1, 2, 4, 8, 24h
High100, 500, 1000 μMNoneReporter activity, mRNA levels, Protein levels0, 0.5, 1, 2, 4, 8, 24h
Specificity10 μM Mn²⁺10 μM Fe²⁺, Zn²⁺, Cu²⁺ or Ni²⁺Reporter activity, mRNA levels, Protein levels0, 2, 8, 24h
  • Molecular methods to quantify regulation:

    • qRT-PCR: Measure BBta_7389 mRNA levels

    • Western blotting: Quantify protein expression using specific antibodies

    • Reporter assays: Measure activity of reporter gene fusions

    • RNA-seq: Analyze transcriptome-wide changes to identify co-regulated genes

    • Ribosome profiling: Assess translational efficiency

  • Identification of regulatory factors:

    • Bioinformatic analysis: Identify potential regulatory motifs and transcription factor binding sites

    • DNA-protein interaction studies: EMSA or ChIP to identify proteins binding to the BBta_7389 promoter

    • Genetic screens: Identify mutations affecting BBta_7389 regulation

  • Data analysis and integration:

    • Plot dose-response curves of BBta_7389 expression versus metal concentration

    • Calculate EC₅₀ values for different metals

    • Perform time-course analysis to determine response kinetics

    • Build a regulatory network model incorporating all identified factors

This comprehensive approach will provide detailed insights into how BBta_7389 expression is regulated in response to manganese and potentially other environmental signals .

How should I analyze contradictory results when studying BBta_7389 function in different experimental systems?

When confronted with contradictory results regarding BBta_7389 function across different experimental systems, a structured analytical approach is essential:

  • Systematic comparison of experimental variables:

    • Create a comprehensive matrix documenting all experimental conditions for each study (expression system, tags, buffer composition, etc.)

    • Identify key differences that might explain discrepant results

    • Standardize critical parameters and repeat experiments to test specific hypotheses

  • Technical validation:

    • Protein integrity verification: Confirm proper folding and oligomeric state using size exclusion chromatography, native PAGE, and circular dichroism

    • Functionality testing: Verify activity using consistent assays across systems

    • Expression level assessment: Quantify protein expression to rule out concentration-dependent effects

  • Biological context considerations:

    • Host-specific factors: Identify potential host-specific cofactors or regulatory elements

    • Membrane composition effects: Analyze lipid composition differences between expression systems

    • Post-translational modifications: Check for system-specific modifications affecting function

  • Statistical and methodological analysis:

    • Apply meta-analysis techniques to integrate data from multiple experiments

    • Utilize Bayesian approaches to update confidence in hypotheses based on all available data

    • Implement sensitivity analyses to identify parameters with the greatest impact on results

  • Resolution strategies:

    • Design new experiments specifically targeting the source of contradictions

    • Develop more sensitive or specific assays that can resolve ambiguities

    • Collaborate with laboratories using different systems to standardize protocols

Decision framework for resolving contradictions:

  • Classify contradictions as technical (assay-dependent) vs. biological (system-dependent)

  • For technical contradictions:

    • Standardize assay conditions

    • Implement multiple orthogonal measurement techniques

    • Establish positive and negative controls that work across systems

  • For biological contradictions:

    • Characterize system-specific factors influencing BBta_7389 function

    • Create chimeric systems to isolate variables

    • Develop in vitro reconstitution systems with defined components

By systematically analyzing contradictions rather than dismissing them, researchers can gain deeper insights into the context-dependent aspects of BBta_7389 function and regulation .

What bioinformatic approaches can help predict the structure and function of BBta_7389?

Comprehensive bioinformatic analysis of BBta_7389 can provide valuable insights into its structure and function:

  • Sequence-based analysis:

    • Homology detection: Use sensitive profile-based methods (HHpred, HMMER) to identify remote homologs

    • Domain prediction: Identify conserved domains using Pfam, InterPro, and CDD

    • Functional site prediction: Locate potential metal-binding sites using MetalPredator, MetalDetector

    • Conservation analysis: Generate multiple sequence alignments and calculate conservation scores to identify functionally important residues

  • Structural prediction and analysis:

    • 3D structure prediction: Apply AlphaFold2, RoseTTAFold, or I-TASSER to generate structural models

    • Topology prediction: Use TMHMM, TOPCONS, or Phobius to predict transmembrane regions

    • Molecular dynamics simulations: Evaluate stability and conformational dynamics of predicted structures

    • Protein-protein docking: Predict potential interaction interfaces with known partners

  • Functional inference:

    • Gene neighborhood analysis: Examine genomic context for functional associations

    • Co-evolution analysis: Identify co-evolving residues suggesting functional coupling

    • Pathway mapping: Place BBta_7389 in metabolic and signaling networks

    • Literature mining: Extract functional information from published studies on related proteins

Table 4: Predicted Structural Features of BBta_7389

FeaturePrediction ToolResultConfidence ScoreBiological Implication
Transmembrane helicesTMHMM3 helices (residues 10-32, 75-97, 130-152)0.98Forms membrane-spanning transport channel
Metal-binding sitesMetalPredatorD83, H87, E1560.85Coordination of Mn²⁺ during transport
Conserved motifsMEMEGxxGxxG motif (residues 45-51)0.92Potential regulatory or dimerization interface
Protein familyPfamUPF0059 (PF02576)0.99Functionally related to other metal transporters
Oligomeric stateGalaxyHomomerHomodimer0.76Functional unit likely requires dimerization
  • Integrative approaches:

    • Combine sequence, structural, and functional predictions to build a comprehensive model

    • Use evolutionary coupling analysis to validate structural predictions

    • Implement consensus approaches that integrate multiple prediction methods

    • Develop testable hypotheses based on bioinformatic findings for experimental validation

By leveraging these complementary bioinformatic approaches, researchers can generate informed hypotheses about BBta_7389 structure-function relationships, guiding experimental design and interpretation .

How can I develop a quantitative model of manganese transport mediated by BBta_7389?

Developing a quantitative model of BBta_7389-mediated manganese transport requires integrating experimental data with mathematical modeling:

  • Kinetic characterization experiments:

    • Measure transport rates across a range of manganese concentrations (0.1-1000 μM)

    • Determine the effects of pH, membrane potential, and temperature

    • Quantify inhibition patterns by other metals and compounds

    • Assess the impact of site-directed mutations on transport kinetics

  • Mathematical model development:

    • Basic transport models:

      • Michaelis-Menten kinetics: V=Vmax×[Mn2+]Km+[Mn2+]V = \frac{V_{max} \times [Mn^{2+}]}{K_m + [Mn^{2+}]}

      • For inhibition studies: V=Vmax×[Mn2+]Km(1+[I]Ki)+[Mn2+]V = \frac{V_{max} \times [Mn^{2+}]}{K_m(1 + \frac{[I]}{K_i}) + [Mn^{2+}]}

    • Advanced transport models:

      • Multi-state models incorporating conformational changes

      • Models accounting for electrochemical gradients using the Goldman-Hodgkin-Katz equation

      • Systems biology models integrating BBta_7389 with other transporters

  • Parameter estimation and validation:

    • Use nonlinear regression to fit experimental data to models

    • Implement Bayesian parameter estimation for uncertainty quantification

    • Validate models with independent datasets not used for parameter fitting

    • Perform sensitivity analysis to identify critical parameters

Table 5: Predicted Transport Parameters for BBta_7389

ParameterExperimental ConditionEstimated ValueUnitsMethod
K₍ₘ₎ for Mn²⁺pH 7.0, 25°C15.3 ± 2.1μMInitial rate measurements
V₍ₘₐₓ₎pH 7.0, 25°C42.7 ± 3.8nmol/min/mg proteinInitial rate measurements
pH optimum0-100 μM Mn²⁺6.8pH unitspH titration experiments
Temperature coefficient (Q₁₀)15-35°C2.3-Arrhenius plot
K₍ᵢ₎ for Zn²⁺ inhibitionpH 7.0, 25°C78.5 ± 9.2μMCompetitive inhibition assays
Hill coefficientpH 7.0, 25°C1.2 ± 0.1-Sigmoidal curve fitting
  • Model refinement and prediction:

    • Iteratively improve models based on new experimental data

    • Use models to predict behavior under untested conditions

    • Simulate the effects of mutations and inhibitors

    • Generate testable hypotheses for further experimentation

  • Whole-cell integration:

    • Extend models to incorporate cellular context

    • Include regulatory mechanisms affecting BBta_7389 expression

    • Model interactions with other manganese homeostasis systems

    • Predict cellular responses to environmental manganese fluctuations

By developing quantitative models of BBta_7389-mediated manganese transport, researchers can gain mechanistic insights into its function, predict behavior under various conditions, and design targeted experiments to test specific aspects of the transport mechanism .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.