Recombinant Branchiostoma floridae ATP synthase subunit a (ATP6)

What is the basic structure and function of Branchiostoma floridae ATP synthase subunit a (ATP6)?

Branchiostoma floridae ATP synthase subunit a (ATP6) is a critical component of the ATP synthase complex (Complex V) involved in the final step of oxidative phosphorylation. This protein forms part of the membrane-embedded F0 segment of ATP synthase that facilitates proton flow across the mitochondrial membrane. The full-length protein consists of 227 amino acids and functions to create a proton channel essential for ATP production .

The protein has a predominantly hydrophobic amino acid sequence (MMVSLFSQFDSPWLLNIPLVLLALIMPWKLFVSFGPSWAGTRSSRLVYATMETLMSQVMQPLNKLGFRWVVLFSSLMLMLMTLNVIGLFPYTFTPTTQLSMNLGLAVPLWLGTVVYGFRNHPVIALAHLCPEGAPNLLVPVLVVVETLSILMRPLALGLRLTANLTAGHLLMHLISSAVLGLMELSVMLSGITLLLLVFLTMLEIAVALIQGYVFAILVTLYLDENL), which is consistent with its role as a transmembrane protein . The hydrophobic nature enables it to be embedded within the mitochondrial membrane where it can participate in the creation of the proton gradient necessary for ATP synthesis.

How does Branchiostoma floridae ATP6 compare structurally to human MT-ATP6?

While both proteins serve similar functions in ATP synthase, Branchiostoma floridae ATP6 represents an important evolutionary link between invertebrates and vertebrates. The human MT-ATP6 and B. floridae ATP6 share conserved domains essential for proton channeling, though the amphioxus protein exhibits some unique structural features reflecting its evolutionary position.

Human MT-ATP6 is encoded by mitochondrial DNA and plays a crucial role in energy production through oxidative phosphorylation. Mutations in human MT-ATP6 are associated with diseases like Leigh syndrome, highlighting its essential function . Branchiostoma floridae ATP6, while serving similar functions, provides researchers with an evolutionary perspective on how this critical energy-producing component has developed across chordate lineages.

What is the most efficient expression system for producing recombinant B. floridae ATP6?

For recombinant expression of Branchiostoma floridae ATP6, E. coli has proven to be an effective heterologous system. The recommended approach involves cloning the full-length coding sequence (1-227aa) into an expression vector with an N-terminal His-tag to facilitate purification . The bacterial expression system offers several advantages:

• High protein yield

• Cost-effectiveness

• Scalability

• Well-established protocols

When expressing B. floridae ATP6 in E. coli, researchers should optimize codon usage to match E. coli preferences, as codon bias can significantly impact expression efficiency. Additionally, using BL21(DE3) or Rosetta E. coli strains may improve expression of this eukaryotic protein. Induction conditions (IPTG concentration, temperature, duration) should be optimized to maximize protein yield while maintaining proper folding .

What purification strategies yield the highest purity of recombinant B. floridae ATP6?

The most effective purification strategy for His-tagged B. floridae ATP6 involves:

• Initial capture using nickel affinity chromatography (Ni-NTA)

• Secondary purification via size exclusion chromatography to remove aggregates

• Optional ion exchange chromatography for removal of contaminants with similar molecular weights

For optimal results, researchers should use a purification buffer containing 50 mM Tris-HCl (pH 8.0), 300 mM NaCl, and 10% glycerol to enhance protein stability. Imidazole gradients (typically 20-250 mM) should be employed during Ni-NTA purification to minimize non-specific binding. The purified protein should yield >90% purity as determined by SDS-PAGE .

How should recombinant B. floridae ATP6 be stored to maintain stability and activity?

To maintain stability and activity of recombinant B. floridae ATP6, the following storage conditions are recommended:

• Short-term storage (up to one week): Store working aliquots at 4°C in Tris/PBS-based buffer (pH 8.0) with 6% trehalose .

• Long-term storage: Store at -20°C/-80°C as a lyophilized powder or in solution with 50% glycerol to prevent freeze-thaw damage .

Repeated freeze-thaw cycles should be strictly avoided as they significantly reduce protein stability. When reconstituting lyophilized protein, use deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL, followed by addition of glycerol (5-50% final concentration) for aliquoting and long-term storage at -20°C/-80°C .

How can recombinant B. floridae ATP6 be used in functional studies of ATP synthase activity?

Recombinant B. floridae ATP6 can be incorporated into liposomes or nanodiscs to reconstitute partial or complete ATP synthase complexes for functional studies. This approach allows researchers to:

• Measure proton conductance through the reconstituted channel

• Assess ATP synthesis rates when combined with other ATP synthase subunits

• Evaluate the effects of mutations on proton translocation

For these assays, researchers should consider:

• Using pH-sensitive fluorescent dyes (e.g., ACMA) to monitor proton movement

• Employing luciferase-based assays to quantify ATP production

• Incorporating membrane potential-sensitive probes to assess electrochemical gradient formation

These functional studies can provide valuable insights into the evolutionary conservation of ATP synthase mechanisms between cephalochordates and vertebrates.

What analytical techniques are most informative for studying B. floridae ATP6 structure-function relationships?

Several analytical techniques provide valuable insights into B. floridae ATP6 structure-function relationships:

• Circular Dichroism (CD) Spectroscopy: For assessing secondary structure composition and thermal stability

• Cross-linking Mass Spectrometry: For identifying interaction interfaces with other ATP synthase subunits

• Cryo-Electron Microscopy: For visualizing the protein within the context of the ATP synthase complex

• Site-Directed Mutagenesis: For evaluating the functional importance of specific residues

• Molecular Dynamics Simulations: For modeling proton movement through the channel

These techniques, when used in combination, can provide a comprehensive understanding of how B. floridae ATP6 contributes to ATP synthase function and how this may differ from vertebrate homologs.

How does B. floridae ATP6 contribute to understanding the evolution of mitochondrial energy production?

B. floridae ATP6 represents a crucial evolutionary link between invertebrate and vertebrate energy production systems. As cephalochordates are considered the closest living invertebrate relatives to vertebrates, studying B. floridae ATP6 provides unique insights into the evolution of mitochondrial ATP synthesis.

Research approaches that can leverage B. floridae ATP6 to understand evolutionary aspects include:

• Comparative sequence analysis with ATP6 proteins across diverse phyla

• Functional complementation studies in ATP6-deficient systems

• Reconstruction of ancestral ATP6 sequences to trace evolutionary changes

• Examination of selective pressures on different ATP6 domains

These approaches can reveal how ATP synthase structure and function have been conserved or modified throughout chordate evolution, potentially identifying adaptations that enabled increased energy efficiency in vertebrates.

Can B. floridae ATP6 be used to study potential therapeutic approaches for human MT-ATP6-related diseases?

Human MT-ATP6 mutations cause serious mitochondrial disorders including Leigh syndrome, which affects approximately 10% of Leigh syndrome patients . B. floridae ATP6 can serve as a valuable research tool for exploring therapeutic approaches through:

• Comparative function studies: Testing whether B. floridae ATP6 can functionally replace defective human MT-ATP6 in cell models

• Drug screening platforms: Using reconstituted systems with B. floridae ATP6 to identify compounds that might enhance ATP synthase activity

• Structure-based drug design: Leveraging the potentially more amenable expression and structural analysis of B. floridae ATP6 to design molecules that could stabilize mutant human MT-ATP6

• Evolutionary insights: Identifying naturally evolved solutions to functional challenges that might be applicable to human disease contexts

These approaches could potentially lead to novel therapeutic strategies for mitochondrial disorders caused by MT-ATP6 mutations.

What is the relationship between B. floridae ATP6 and amphioxus ApeC-containing proteins (ACPs)?

Recent research has revealed interesting connections between mitochondrial proteins and immune function in amphioxus. While ATP6 functions primarily in energy production, it shares evolutionary relationships with certain ApeC-containing proteins (ACPs) that play roles in pathogen recognition and immune signaling in Branchiostoma species.

Two ACPs from B. floridae (bfACP3 and bfACP5) have been shown to bind to microbial cell wall components through their ApeC domains . These proteins can:

• Directly interact with peptidoglycan (PGN) from bacterial cell walls

• Bind to specific components like GlcNAc (NAG) and MurNAc (NAM)

• Potentially participate in antimicrobial defense mechanisms

This functional crossover between energy metabolism and immune response represents an intriguing area for evolutionary research, suggesting ancient connections between these vital cellular systems.

How can the interaction between bfACP3 and the TRAF6-NF-κB pathway inform studies of B. floridae ATP6?

Research has demonstrated that bfACP3 from B. floridae can negatively regulate the MyD88-TRAF6-NF-κB signaling pathway by:

• Directly interacting with bfTRAF6 in co-immunoprecipitation assays

• Co-localizing with bfTRAF6 in subcellular structures

• Suppressing the polyubiquitination of bfTRAF6

• Inhibiting NF-κB activation in a dose-dependent manner

These findings suggest complex interconnections between immune signaling and metabolic regulation in amphioxus. Researchers studying B. floridae ATP6 should consider potential moonlighting functions or evolutionary relationships with immune-related proteins, particularly since mitochondrial function is increasingly recognized as an important regulator of immune responses across species.

What are the main challenges in working with recombinant B. floridae ATP6 and how can they be overcome?

Recombinant production of membrane proteins like B. floridae ATP6 presents several challenges:

Researchers should carefully optimize each step of the expression and purification process, with particular attention to maintaining the hydrophobic environment necessary for proper folding of this membrane protein .

How can researchers validate the proper folding and functionality of recombinant B. floridae ATP6?

Validating proper folding and functionality of recombinant B. floridae ATP6 requires multiple complementary approaches:

• Structural validation:

  • Circular dichroism spectroscopy to confirm alpha-helical content

  • Limited proteolysis to assess compact folding

  • Size exclusion chromatography to evaluate monodispersity

• Functional validation:

  • Reconstitution into liposomes and measurement of proton conductance

  • Assembly with other ATP synthase subunits to form functional complexes

  • Patch-clamp electrophysiology to assess channel properties

• Interaction validation:

  • Binding assays with known ATP synthase partner subunits

  • Co-immunoprecipitation with other components of the ATP synthase complex

  • Crosslinking studies to confirm native-like topology

Each validation approach provides complementary information about protein quality, helping researchers ensure their recombinant protein retains native-like properties suitable for downstream applications.