Recombinant Branchiostoma floridae Cytochrome c oxidase subunit 2 (COII)
Shipped with Ice Packs 
In Stock 
Product Specs
Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Note: While we will prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted as needed.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: Tag type is determined during production. Please specify your required tag type for preferential development.
Note: Tag type is determined during production. Please specify your required tag type for preferential development.
Synonyms
COII; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-230
Protein Length
full length protein
Species
Branchiostoma floridae (Florida lancelet) (Amphioxus)
Target Names
COII
Target Protein Sequence
MATPAQLGLMDAASPVMEEMIYFHDHVMLVLILITCLIFYSMLVLISSKYIYRFLTDGHV
IETVWTVIPAIILVVVALPSLKLLYLTDELDNPQLTIKSVGHQWYWSYEYTDYYDIEFDS
YMLPLGDLSKGDARLLEVDNRVVLPVDTSVRVLVTAADVIHSWTVPSLGLKMDAVPGRLN
QLALQCSRVGTFYGQCSEICGANHSFMPIVIEAVPVEVFEGWCDMMLDEE
Uniprot No.
Target Background
Function
Cytochrome c oxidase subunit 2 (COII) is a component of cytochrome c oxidase (Complex IV), the terminal enzyme in the mitochondrial electron transport chain. This enzyme drives oxidative phosphorylation by facilitating electron transfer from reduced cytochrome c to molecular oxygen, producing water. The respiratory chain comprises three multi-subunit complexes (Complex II, III, and IV) that collaborate to transfer electrons from NADH and succinate to oxygen, generating an electrochemical gradient across the inner mitochondrial membrane. This gradient powers ATP synthesis. Within Complex IV, electrons are transferred via the CuA center and heme A to the binuclear center (heme a3 and CuB), where oxygen reduction to water occurs. This process utilizes four electrons from cytochrome c and four protons from the mitochondrial matrix.
Database Links
KEGG: bfo:COX2
Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
