Recombinant Branchiostoma floridae NADH-ubiquinone oxidoreductase chain 3 (ND3)

Shipped with Ice Packs
In Stock

Description

Taxonomic Classification and Significance

Branchiostoma floridae, commonly known as the Florida lancelet or amphioxus, is a cephalochordate of significant evolutionary importance. This organism has garnered considerable scientific interest as it represents a crucial evolutionary link between invertebrates and vertebrates. Found primarily in marine environments, B. floridae serves as a model organism for understanding chordate evolution and development .

Genomic Characteristics

The genome of B. floridae has been extensively studied through resequencing efforts, revealing substantial genetic variation. Recent genomic analyses have identified over 140 million genomic variations across B. floridae individuals, with the genome annotation containing approximately 28,621 genes after removing duplicate records, pseudogenes, and non-coding RNA genes . This extensive genetic characterization provides a foundation for understanding specific proteins like ND3 within this species.

Molecular Characterization

NADH-ubiquinone oxidoreductase chain 3 (ND3) is a component of the mitochondrial respiratory chain complex I, which plays a critical role in cellular energy production. While the specific sequence of B. floridae ND3 is not directly provided in the available research, comparative analysis with other species suggests it likely functions as an integral membrane protein involved in electron transport .

Functional Role in Energy Metabolism

ND3 facilitates the transfer of electrons from NADH to ubiquinone, contributing to the proton gradient necessary for ATP synthesis. This function is highly conserved across species, making it an essential component of cellular respiration. The protein's role in energy metabolism positions it as a critical factor in understanding the metabolic functions of B. floridae .

Comparative Genomics

Genetic analyses across Branchiostoma species reveal important insights into their evolutionary relationships and genetic diversity. Studies have shown varying levels of heterozygosity among B. floridae individuals, ranging from approximately 1.68% to 2.01%, depending on sequencing depth . This genetic diversity likely extends to mitochondrial genes including ND3, though specific documentation of ND3 variation is not explicitly detailed in the current research.

Population Genetics and Historical Demographics

Whole-genome resequencing of Branchiostoma individuals has enabled the reconstruction of historical population dynamics. Using the pairwise sequentially Markovian coalescent (PSMC) method, researchers have estimated changes in effective population size during the Pleistocene period. These analyses have revealed population bottlenecks coinciding with glacial periods, followed by expansion during the late Pleistocene . Such demographic histories would have influenced the evolution of mitochondrial genes including ND3.

Expression Systems for Recombinant Proteins

Recombinant proteins are typically produced using established expression systems like Escherichia coli. While specific methods for B. floridae ND3 production are not detailed in the available research, comparable recombinant mitochondrial proteins are commonly expressed with fusion tags (such as His-tags) to facilitate purification . Based on related recombinant protein production methods, E. coli would likely serve as an appropriate expression system for B. floridae ND3.

Predicted Protein Properties

Drawing from information about similar proteins, recombinant B. floridae ND3 would likely be produced as a full-length protein corresponding to the native mitochondrial gene. The protein would likely retain its hydrophobic transmembrane domains, making solubilization potentially challenging without appropriate detergents or fusion partners .

Evolutionary Studies

Recombinant B. floridae ND3 would provide valuable material for evolutionary studies examining the conservation and divergence of mitochondrial proteins across chordates. As amphioxus occupies a unique evolutionary position, its mitochondrial proteins offer insights into the transition from invertebrate to vertebrate energy metabolism .

Functional Characterization

Purified recombinant ND3 could enable detailed biochemical and structural studies to understand its specific role in the respiratory chain. Such characterization would contribute to our understanding of mitochondrial function in this evolutionarily significant organism. Additionally, functional studies could reveal adaptations specific to the marine environment inhabited by B. floridae .

Antibody Production and Localization Studies

Recombinant proteins serve as excellent antigens for antibody production. Antibodies against B. floridae ND3 would facilitate immunolocalization studies to determine the protein's distribution in tissues and cells, potentially revealing tissue-specific expression patterns or developmental regulation .

Reconstitution Protocols

Lyophilized recombinant proteins typically require reconstitution in appropriate buffers. For membrane proteins like ND3, special consideration would be needed regarding buffer composition and potential inclusion of detergents to maintain solubility . A Tris/PBS-based buffer system with controlled pH (around 8.0) would likely be suitable for initial reconstitution.

Current Knowledge Gaps

Despite significant advances in Branchiostoma genomics, specific studies on recombinant B. floridae ND3 remain limited. Future research should focus on expression, purification, and functional characterization of this protein to better understand its role in amphioxus biology and evolution.

Conservation Implications

The documented population bottlenecks in Branchiostoma species highlight the potential vulnerability of these organisms to environmental changes. Recent anthropogenic activities, including industrial pollution and exploitation of sea sand, have further threatened amphioxus habitats . Conservation efforts are essential to preserve these evolutionarily significant organisms and enable continued research on their unique biology.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will accommodate your request as best as possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please notify us in advance as additional charges will apply.
Notes
Repeated freeze-thaw cycles are not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can serve as a reference point for your preparation.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid protein is 6 months at -20°C/-80°C. For lyophilized protein, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot the protein for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us. We will prioritize developing the specified tag if possible.
Synonyms
ND3; NAD3; NADH3; NADH-ubiquinone oxidoreductase chain 3; NADH dehydrogenase subunit 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-117
Protein Length
full length protein
Species
Branchiostoma floridae (Florida lancelet) (Amphioxus)
Target Names
ND3
Target Protein Sequence
MLSLTYIVGIASALVIILLLVGLHLPSVMPDNEKLSAYECGFDPMGNARLPFSLRFFLVA ILFLLFDLEIALILPYPLGVVFSENTFYNYWLVMLLVVVLTFGLMYEWLKGGLEWTE
Uniprot No.

Target Background

Function
This protein is the core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). It is believed to be part of the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is thought to be ubiquinone.
Database Links

KEGG: bfo:ND3

Protein Families
Complex I subunit 3 family
Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein.

Q&A

What is Branchiostoma floridae NADH-ubiquinone oxidoreductase chain 3 (ND3) and what is its role in cellular metabolism?

NADH-ubiquinone oxidoreductase chain 3 (ND3) in Branchiostoma floridae is a mitochondrial protein component of Complex I in the electron transport chain. This 117-amino acid protein plays a critical role in oxidative phosphorylation, the process by which cells generate ATP. As part of Complex I, ND3 facilitates electron transfer from NADH to ubiquinone, contributing to the establishment of a proton gradient across the inner mitochondrial membrane. This gradient is subsequently utilized by ATP synthase to produce ATP.

The amino acid sequence (MLSLTYIVGIASALVIILLLVGLHLPSVMPDNEKLSAYECGFDPMGNARLPFSLRFFLVAILFLLFDLEIALILPYPLGVVFSENTFYNYWLVMLLVVVLTFGLMYEWLKGGLEWTE) reveals its highly hydrophobic nature, consistent with its role as a transmembrane protein integrated into the inner mitochondrial membrane .

Why is Branchiostoma floridae ND3 significant for evolutionary biology research?

Branchiostoma (amphioxus) occupies a strategic position in chordate evolution as a basal cephalochordate. Studying its mitochondrial proteins like ND3 provides valuable insights into the evolution of energy metabolism in chordates. The conservation or divergence of ND3's structure and function compared to vertebrate homologs helps researchers understand the evolutionary trajectory of mitochondrial respiratory complexes.

Demographic inference has revealed that Branchiostoma species have undergone population expansions and contractions corresponding to major geological epochs, with notable expansion during the interglacial Greenlandian stage . This evolutionary history makes its mitochondrial genes, including ND3, particularly interesting for studying adaptation and selection in energy metabolism across evolutionary timescales.

How does recombinant Branchiostoma floridae ND3 protein differ from its native form?

The recombinant Branchiostoma floridae ND3 protein produced in E. coli systems differs from its native form in several important ways:

  • Addition of an N-terminal His-tag, which facilitates purification but may affect protein folding or function

  • Expression in a prokaryotic system (E. coli) rather than its native eukaryotic mitochondrial environment

  • Lack of post-translational modifications that might occur in the native context

  • Isolation in a water-soluble lyophilized form, whereas the native protein is membrane-embedded

  • Absence of interaction partners normally present in Complex I

These differences must be considered when designing experiments using the recombinant protein, as they may affect structure-function relationships .

What are the most effective experimental approaches for studying the functional properties of recombinant Branchiostoma floridae ND3?

For comprehensive functional characterization of recombinant Branchiostoma floridae ND3, researchers should consider a multi-tiered experimental approach:

  • Biochemical activity assays: Measure NADH oxidation rates and electron transfer efficiency using spectrophotometric methods.

  • Reconstitution experiments: Incorporate the recombinant protein into liposomes or nanodiscs to study membrane integration and function in a lipid environment.

  • Interaction studies: Use pull-down assays, co-immunoprecipitation, or surface plasmon resonance (SPR) to identify binding partners and characterize protein-protein interactions with other Complex I components.

  • Structural analysis: Apply techniques such as circular dichroism (CD) spectroscopy to assess secondary structure, and consider X-ray crystallography or cryo-electron microscopy for detailed structural insights.

  • Comparative analyses: Perform side-by-side functional comparisons with ND3 from other species to identify conserved and divergent functional properties.

When conducting these studies, researchers should reconstitute the lyophilized protein according to manufacturer specifications (0.1-1.0 mg/mL in deionized sterile water) and consider adding glycerol (5-50%) for long-term storage .

How can researchers effectively design experiments to study the interaction between recombinant ND3 and other components of the respiratory chain?

When investigating interactions between recombinant Branchiostoma floridae ND3 and other respiratory chain components, researchers should:

  • Co-expression systems: Design bacterial or eukaryotic expression systems that co-express ND3 with other Complex I subunits to allow for proper complex assembly.

  • Crosslinking experiments: Utilize chemical crosslinkers with various spacer arm lengths to capture transient or stable interactions between ND3 and neighboring proteins.

  • Microscale thermophoresis (MST): Employ this technique to quantitatively measure binding affinities between ND3 and other purified respiratory chain components.

  • Blue native PAGE: Use this non-denaturing electrophoresis technique to analyze complex formation and stability.

  • Computational modeling: Perform in silico docking studies to predict interaction interfaces based on the amino acid sequence provided (MLSLTYIVGIASALVIILLLVGLHLPSVMPDNEKLSAYECGFDPMGNARLPFSLRFFLVAILFLLFDLEIALILPYPLGVVFSENTFYNYWLVMLLVVVLTFGLMYEWLKGGLEWTE) .

  • FRET-based approaches: Develop fluorescently labeled versions of ND3 and potential interaction partners to monitor real-time interactions using Förster Resonance Energy Transfer.

Researchers should be aware that the His-tag on the recombinant protein might influence interaction profiles and consider including controls with tag-cleaved proteins.

What are the challenges and solutions in expressing and purifying functional Branchiostoma floridae ND3 for structural studies?

Expressing and purifying functional Branchiostoma floridae ND3 presents several challenges due to its hydrophobic nature and normal mitochondrial localization:

Challenges:

  • Protein misfolding in non-native expression systems

  • Formation of inclusion bodies in bacterial expression systems

  • Toxicity to host cells due to membrane integration

  • Low yield of properly folded protein

  • Difficulty maintaining stability during purification

  • Aggregation in aqueous solutions

Solutions:

  • Optimized expression systems: Use specialized E. coli strains (e.g., C41(DE3), C43(DE3)) designed for membrane protein expression.

  • Fusion partners: Employ solubility-enhancing fusion partners such as MBP, SUMO, or thioredoxin in addition to the His-tag.

  • Detergent screening: Systematically test multiple detergents (DDM, LMNG, CHAPS) for optimal extraction and stabilization.

  • Amphipol exchange: Replace detergents with amphipols for increased stability during structural studies.

  • Co-expression with chaperones: Include molecular chaperones in the expression system to aid proper folding.

  • Nanodiscs incorporation: Transfer purified protein into nanodiscs for a more native-like lipid environment.

For successful SDS-PAGE analysis as mentioned in the product specifications , ensure proper sample preparation with appropriate reducing agents and detergents to prevent aggregation during electrophoresis.

What are the optimal storage and handling conditions for recombinant Branchiostoma floridae ND3 to maintain its structural integrity and functional activity?

To maintain optimal structural integrity and functional activity of recombinant Branchiostoma floridae ND3, researchers should follow these evidence-based protocols:

Storage conditions:

  • Store lyophilized protein at -20°C or -80°C upon receipt

  • After reconstitution, add glycerol to a final concentration of 5-50% (with 50% being optimal according to manufacturer recommendations)

  • Store working aliquots at 4°C for no more than one week

  • For long-term storage of reconstituted protein, prepare small aliquots to avoid repeated freeze-thaw cycles

  • Store in Tris/PBS-based buffer at pH 8.0 with 6% trehalose for stability

Handling recommendations:

  • Briefly centrifuge vials before opening to bring contents to the bottom

  • Reconstitute to a concentration of 0.1-1.0 mg/mL in deionized sterile water

  • Always use sterile techniques when handling the protein

  • Allow protein to equilibrate to room temperature before conducting experiments

  • When thawing frozen aliquots, thaw rapidly in a 25°C water bath and use immediately

  • Avoid vortexing; instead, mix by gentle pipetting or inversion

Following these guidelines will help prevent protein degradation, aggregation, and loss of activity during storage and experimental procedures .

How can researchers validate the functional activity of recombinant Branchiostoma floridae ND3 before using it in complex experimental setups?

Before incorporating recombinant Branchiostoma floridae ND3 into complex experimental designs, researchers should validate its functional activity using these methodological approaches:

  • Thermal shift assays: Measure the protein's thermal stability using differential scanning fluorimetry (DSF) with SYPRO Orange dye to confirm proper folding.

  • Limited proteolysis: Perform time-course digestion with proteases like trypsin or chymotrypsin to assess structural integrity; properly folded membrane proteins show characteristic proteolytic patterns.

  • Electron transfer activity: Develop a simplified assay using artificial electron acceptors like ferricyanide to measure electron transfer activity.

  • NADH consumption assay: Monitor NADH oxidation spectrophotometrically at 340 nm in the presence of ubiquinone analogs.

  • Antibody recognition: Use conformational antibodies to confirm that the recombinant protein maintains native-like epitopes.

  • Lipid binding assays: Assess the protein's ability to associate with lipids using fluorescent lipid analogs or liposome co-sedimentation assays.

  • Size exclusion chromatography: Confirm the protein's oligomeric state and homogeneity before functional studies.

When conducting SDS-PAGE analysis as suggested in the product specifications , compare migration patterns with predicted molecular weights (approximately 15 kDa including the His-tag) to confirm identity and integrity.

What techniques can be used to study the interaction between recombinant Branchiostoma floridae ND3 and the mitochondrial membrane?

To investigate interactions between recombinant Branchiostoma floridae ND3 and mitochondrial membranes, researchers can employ these advanced biophysical and biochemical techniques:

  • Liposome reconstitution assays:

    • Prepare liposomes with compositions mimicking mitochondrial inner membrane

    • Incorporate purified ND3 using detergent-mediated reconstitution

    • Assess incorporation efficiency using flotation assays on sucrose gradients

    • Measure changes in membrane properties using fluorescent probes

  • Solid-state NMR spectroscopy:

    • Isotopically label the recombinant protein (¹⁵N, ¹³C)

    • Reconstitute in defined lipid bilayers

    • Analyze protein-lipid interactions and membrane topology

  • Atomic force microscopy (AFM):

    • Visualize ND3 integration into supported lipid bilayers

    • Measure force-distance curves to assess membrane binding strength

    • Map topography of membrane-inserted protein complexes

  • Tryptophan fluorescence spectroscopy:

    • Exploit the natural tryptophan in the ND3 sequence (MLSLTYIVGIASALVIILLLVGLHLPSVMPDNEKLSAYECGFDPMGNARLPFSLRFFLVAILFLLFDLEIALILPYPLGVVFSENTFYNYWLVMLLVVVLTFGLMYEWLKGGLEWTE)

    • Monitor changes in emission spectra upon membrane interaction

    • Determine depth of membrane insertion using acrylamide quenching

  • Neutron reflectometry:

    • Characterize the structural organization of ND3 in model membranes

    • Determine the orientation and penetration depth in lipid bilayers

  • Molecular dynamics simulations:

    • Build computational models of ND3 in various membrane environments

    • Simulate protein behavior and identify key lipid interaction residues

    • Generate hypotheses for experimental validation

These techniques provide complementary information about how the recombinant protein interacts with mitochondrial membranes, offering insights into its native functional environment.

How can recombinant Branchiostoma floridae ND3 be used in comparative studies with vertebrate ND3 to understand evolutionary conservation of Complex I function?

Recombinant Branchiostoma floridae ND3 serves as an excellent tool for evolutionary comparative studies with vertebrate homologs, illuminating the conservation and divergence of Complex I function throughout chordate evolution. Recommended methodological approaches include:

  • Sequence-structure-function analysis:

    • Align the Branchiostoma floridae ND3 sequence (MLSLTYIVGIASALVIILLLVGLHLPSVMPDNEKLSAYECGFDPMGNARLPFSLRFFLVAILFLLFDLEIALILPYPLGVVFSENTFYNYWLVMLLVVVLTFGLMYEWLKGGLEWTE) with vertebrate homologs

    • Map conserved residues onto structural models

    • Correlate conservation patterns with functional domains

  • Cross-species complementation assays:

    • Express Branchiostoma floridae ND3 in vertebrate cell lines with ND3 mutations or deletions

    • Assess rescue of mitochondrial function through respirometry, membrane potential measurements, and ROS production

  • Chimeric protein generation:

    • Create fusion proteins combining domains from Branchiostoma and vertebrate ND3

    • Identify functionally interchangeable regions vs. species-specific elements

    • Express in heterologous systems to assess functional properties

  • Biophysical characterization comparison:

    • Conduct parallel thermal stability, pH sensitivity, and redox potential measurements

    • Compare kinetic parameters of electron transfer activity

    • Assess protein-lipid interactions across species

  • Interaction partner conservation analysis:

    • Perform cross-species interaction studies with other Complex I subunits

    • Identify conserved vs. divergent interaction interfaces

    • Map the evolution of Complex I assembly pathways

These approaches leverage Branchiostoma's position as a basal chordate to illuminate the evolutionary trajectory of mitochondrial electron transport systems, providing insights into both conserved core functions and adaptations specific to vertebrate lineages .

What role can recombinant Branchiostoma floridae ND3 play in understanding mitochondrial disease mechanisms?

Recombinant Branchiostoma floridae ND3 can serve as a valuable research tool for understanding mitochondrial disease mechanisms, particularly those involving Complex I dysfunction, through several methodological approaches:

  • Model system for pathogenic mutations:

    • Introduce mutations corresponding to human disease variants into the Branchiostoma ND3 sequence

    • Express and characterize these variants to assess functional impacts

    • Use the simplified cephalochordate system to isolate mutation effects from confounding factors

  • Structure-function relationships:

    • The conserved residues between human and Branchiostoma ND3 can help identify critical functional domains

    • Mutations in these domains likely cause similar bioenergetic defects across species

    • Use site-directed mutagenesis to create a library of variants for functional screening

  • Oxidative stress mechanisms:

    • Investigate how specific ND3 mutations affect ROS production

    • Compare oxidative damage patterns between wild-type and mutant forms

    • Develop biomarkers for mitochondrial dysfunction based on these patterns

  • Drug screening platform:

    • Use recombinant Branchiostoma ND3 variants as targets for small molecule screening

    • Identify compounds that restore function to mutant proteins

    • Develop targeted therapies for ND3-related mitochondrial disorders

  • Complementation studies:

    • Express Branchiostoma ND3 in human cell lines harboring ND3 mutations

    • Assess the degree of functional rescue

    • Identify conserved vs. species-specific disease mechanisms

Recombinant ND3 can particularly enhance our understanding of mitochondrial DNA mutations that are associated with various human diseases , providing both mechanistic insights and potential therapeutic approaches.

How can recombinant ND3 contribute to understanding the unique aspects of Branchiostoma mitochondrial function in relation to its lifestyle and evolution?

Recombinant Branchiostoma floridae ND3 provides a unique window into cephalochordate-specific mitochondrial adaptations that reflect this organism's evolutionary history and ecological niche:

  • Metabolic rate adaptation studies:

    • Compare kinetic properties of Branchiostoma ND3 with those of other marine organisms

    • Correlate enzymatic efficiency with the burrowing, filter-feeding lifestyle

    • Investigate temperature and salinity tolerance of protein function

  • Evolutionary adaptation analysis:

    • Examine polymorphisms in the ND3 gene across Branchiostoma populations

    • Correlate genetic variants with environmental factors

    • Assess evidence of positive selection on specific residues

  • Cross-functional genomic integration:

    • Connect ND3 function to broader genomic studies of Branchiostoma

    • Analyze how mitochondrial energy production relates to other metabolic pathways

    • Integrate with demographic data showing population expansions during interglacial periods

  • Specialized metabolic requirements:

    • Study how ND3 function supports the unique digestive processes in Branchiostoma

    • Investigate connections to the phagocytic intracellular digestion capacity

    • Examine the energetic demands of digestive and immune gene groups

  • Developmental energy dynamics:

    • Correlate ND3 activity with expression patterns of developmental genes

    • Investigate mitochondrial function during key developmental transitions

    • Connect to gene regulatory networks in neural and epidermal tissues

These research approaches can reveal how mitochondrial function in Branchiostoma has been shaped by its evolutionary history and ecological adaptations, providing insights into both conserved and lineage-specific aspects of bioenergetics in this important chordate model organism.

What are common technical challenges when working with recombinant Branchiostoma floridae ND3 and how can they be addressed?

Researchers working with recombinant Branchiostoma floridae ND3 frequently encounter several technical challenges. Here are evidence-based solutions for addressing these issues:

ChallengeCauseSolution
Protein aggregation after reconstitutionHydrophobic transmembrane domainsAdd 0.1-0.5% mild detergent (DDM or LMNG); reconstitute at lower concentrations (0.1 mg/mL); use sonication to disperse aggregates
Poor solubilityMembrane protein characteristicsUtilize specialized solubilization buffers containing chaotropic agents; explore different detergent types and concentrations
Inconsistent SDS-PAGE migrationHydrophobic nature affecting SDS bindingInclude 8M urea in sample buffer; heat samples at 70°C instead of boiling; use specialized membrane protein gel systems
Rapid activity lossStructural instability outside membraneWork with freshly reconstituted protein; maintain constant low temperature (4°C); add stabilizers like trehalose
Interference with functional assaysHis-tag effectsConsider using TEV protease to remove the His-tag; design control experiments with and without tag cleavage
Batch-to-batch variabilityExpression system inconsistenciesStandardize purification protocols; perform quality control tests for each batch; pool batches when possible

When storing reconstituted protein, follow the manufacturer's recommendation to add glycerol (5-50%, with 50% being optimal) and store as small aliquots to prevent freeze-thaw damage .

How can researchers distinguish between artifacts caused by the recombinant expression system and genuine properties of Branchiostoma floridae ND3?

Distinguishing between expression system artifacts and genuine properties of Branchiostoma floridae ND3 requires rigorous experimental controls and comparative analyses:

  • Comparison with native protein:

    • Extract native Complex I from Branchiostoma mitochondria

    • Compare biochemical properties with the recombinant version

    • Identify discrepancies that may represent artifacts

  • Multiple expression systems:

    • Express ND3 in various systems (E. coli, yeast, insect cells)

    • Compare properties across expression platforms

    • Features consistent across systems likely represent genuine properties

  • Tag impact assessment:

    • Express variants with different tags (His, GST, FLAG)

    • Compare with tag-free versions after protease cleavage

    • Identify tag-dependent effects on structure or function

  • Reconstitution validation:

    • Compare properties in different membrane mimetics (detergents, nanodiscs, liposomes)

    • Features that depend heavily on the membrane environment require careful interpretation

    • Identify properties that are robust across different environments

  • Functional context controls:

    • Express ND3 along with interacting partners from Complex I

    • Compare properties of isolated vs. complex-integrated protein

    • Distinguish context-dependent properties from intrinsic characteristics

  • Bioinformatic prediction validation:

    • Compare experimental results with in silico predictions based on the known sequence (MLSLTYIVGIASALVIILLLVGLHLPSVMPDNEKLSAYECGFDPMGNARLPFSLRFFLVAILFLLFDLEIALILPYPLGVVFSENTFYNYWLVMLLVVVLTFGLMYEWLKGGLEWTE)

    • Discrepancies may indicate expression artifacts

By systematically applying these approaches, researchers can build confidence in which properties represent genuine characteristics of Branchiostoma floridae ND3 versus artifacts introduced by the recombinant expression system.

What quality control measures should be implemented when working with recombinant Branchiostoma floridae ND3 for reproducible research?

To ensure reproducible research with recombinant Branchiostoma floridae ND3, implement these comprehensive quality control measures throughout your experimental workflow:

Pre-experimental quality assessment:

  • Purity verification:

    • Confirm >90% purity via SDS-PAGE as specified in product information

    • Consider additional methods like silver staining for higher sensitivity

    • Perform mass spectrometry to verify protein identity and detect contaminants

  • Structural integrity analysis:

    • Conduct circular dichroism to assess secondary structure composition

    • Perform thermal shift assays to determine protein stability

    • Use dynamic light scattering to evaluate homogeneity and detect aggregates

  • Functional activity baseline:

    • Establish standardized activity assays with defined acceptance criteria

    • Maintain reference protein aliquots for batch-to-batch comparison

    • Document specific activity values under standardized conditions

Experimental controls:

  • Negative controls:

    • Include heat-denatured protein samples

    • Use unrelated proteins with similar structural properties

    • Prepare mock preparations from empty vector expressions

  • Positive controls:

    • Where available, include native Complex I preparations

    • Use well-characterized related proteins from model organisms

    • Maintain internal reference standards across experiments

Documentation and reporting:

  • Detailed methods documentation:

    • Record all buffer compositions, including pH and additives

    • Document protein concentration determination method

    • Note batch number, storage conditions, and time from reconstitution

  • Standardized reporting:

    • Develop laboratory standard operating procedures (SOPs)

    • Use electronic lab notebooks with version control

    • Include raw data alongside processed results

  • Metadata capture:

    • Record environmental conditions (temperature, humidity)

    • Document equipment calibration status

    • Note any deviations from standard protocols

Implementing these quality control measures will minimize variability, enhance reproducibility, and increase confidence in research findings involving recombinant Branchiostoma floridae ND3.

What emerging technologies could enhance our understanding of Branchiostoma floridae ND3 structure-function relationships?

Several cutting-edge technologies are poised to revolutionize our understanding of Branchiostoma floridae ND3's structure-function relationships:

  • Cryo-electron microscopy (Cryo-EM):

    • Potential for high-resolution structural determination without crystallization

    • Ability to visualize ND3 in complex with interacting partners

    • Opportunity to capture different functional states of the protein

    • Resolution capable of visualizing the detailed membrane integration of transmembrane helices

  • AlphaFold2 and deep learning approaches:

    • Prediction of accurate 3D structures based on the amino acid sequence (MLSLTYIVGIASALVIILLLVGLHLPSVMPDNEKLSAYECGFDPMGNARLPFSLRFFLVAILFLLFDLEIALILPYPLGVVFSENTFYNYWLVMLLVVVLTFGLMYEWLKGGLEWTE)

    • Integration with experimental data for improved modeling

    • Prediction of protein dynamics and conformational changes

  • Single-molecule techniques:

    • FRET-based approaches to monitor protein dynamics in real-time

    • Optical tweezers to measure mechanical forces during conformational changes

    • Single-molecule electrophysiology to measure electron transfer events

  • In-cell structural biology:

    • Cellular cryo-electron tomography for visualizing ND3 in its native environment

    • In-cell NMR for studying protein dynamics in a cellular context

    • Proximity labeling approaches to map interaction networks

  • Microfluidic-based functional assays:

    • High-throughput screening of ND3 variants

    • Precise control of biochemical environments

    • Real-time monitoring of protein function

  • Integrative structural biology:

    • Combining data from multiple techniques (X-ray, NMR, SAXS, Cryo-EM)

    • Computational integration for comprehensive structural models

    • Correlating structure with evolutionary conservation patterns in Branchiostoma populations

These emerging technologies will provide unprecedented insights into how ND3's structure relates to its role in mitochondrial function and may reveal novel therapeutic targets for mitochondrial disorders involving Complex I dysfunction .

How might research on Branchiostoma floridae ND3 inform our understanding of human mitochondrial disorders?

Research on Branchiostoma floridae ND3 has significant translational potential for understanding human mitochondrial disorders through several mechanistic pathways:

  • Evolutionary conserved disease mechanisms:

    • Identification of functionally critical residues conserved from Branchiostoma to humans

    • Mutations in these residues likely cause similar dysfunctions across species

    • The simpler Branchiostoma system can isolate primary effects from compensatory mechanisms

  • Structure-function insights:

    • The recombinant Branchiostoma ND3 can serve as a model for human ND3-related disorders

    • Detailed structural studies can reveal how mutations disrupt electron transport

    • Creation of a "mutation map" linking specific residues to functional outcomes

  • Novel biomarkers:

    • Identification of specific metabolic signatures associated with ND3 dysfunction

    • Development of diagnostic markers for early detection of mitochondrial disorders

    • Correlation of biochemical changes with clinical phenotypes

  • Therapeutic development platforms:

    • Screening platforms using recombinant Branchiostoma ND3 for drug discovery

    • Identification of compounds that can rescue mutant protein function

    • Development of targeted therapies for specific mutations

  • Pathogenic mechanism elucidation:

    • Understanding how ND3 mutations affect ROS production

    • Clarifying the relationship between mitochondrial DNA mutations and disease phenotypes

    • Dissecting primary vs. secondary effects of mutations

  • Genetic interaction networks:

    • Mapping genetic modifiers that influence ND3 function

    • Identification of compensatory mechanisms that could be therapeutically enhanced

    • Understanding the broader mitochondrial response to Complex I dysfunction

By leveraging the evolutionary relationship between Branchiostoma and human ND3, researchers can gain fundamental insights into mitochondrial disease mechanisms while developing targeted approaches for diagnosis and treatment.

What are promising directions for integrating Branchiostoma floridae ND3 research with systems biology approaches?

Integration of Branchiostoma floridae ND3 research with systems biology approaches offers exciting opportunities for comprehensive understanding of mitochondrial function in biological systems:

  • Multi-omics integration:

    • Combine proteomic data on ND3 interactions with transcriptomic profiles

    • Correlate mitochondrial function with metabolomic signatures

    • Develop computational models that predict system-wide effects of ND3 variants

    • Connect to genomic studies revealing population-level variations

  • Network-based analyses:

    • Map the protein-protein interaction network centered on ND3

    • Identify regulatory hubs that control Complex I assembly and function

    • Model how perturbations propagate through mitochondrial networks

    • Connect to broader cellular energetic networks

  • Developmental energy dynamics:

    • Integrate ND3 function with developmental gene regulatory networks

    • Study how energy metabolism supports specific developmental processes

    • Connect mitochondrial function to cell fate decisions in neural and epidermal tissues

    • Model metabolic rewiring during developmental transitions

  • Ecological and evolutionary integration:

    • Connect mitochondrial function to adaptation in different environments

    • Model how energy metabolism supported population expansions during interglacial periods

    • Integrate with studies on intracellular digestion and immune function

    • Develop evolutionary models of mitochondrial adaptation

  • Predictive modeling:

    • Create mathematical models of electron transport kinetics

    • Simulate effects of environmental perturbations on mitochondrial function

    • Predict phenotypic outcomes of specific ND3 variants

    • Model therapeutic responses based on mechanistic understanding

  • Spatial organization modeling:

    • Map ND3 within the three-dimensional organization of mitochondria

    • Model how spatial arrangement affects functional efficiency

    • Integrate with mitochondrial dynamics and quality control pathways

    • Connect to cellular architecture and tissue-specific energy demands

These integrative approaches will place ND3 research in a broader biological context, revealing emergent properties and systems-level insights that cannot be obtained through reductionist approaches alone.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.