Recombinant Branchiostoma floridae NADH-ubiquinone oxidoreductase chain 6 (ND6)

Shipped with Ice Packs
In Stock

Description

  • Repeated freeze-thaw cycles are avoided to preserve stability .

  • Glycerol (5–50%) is added to lyophilized forms for long-term storage .

ELISA Assays

Recombinant ND6 is used in enzyme-linked immunosorbent assays (ELISA) to detect protein levels in mitochondrial studies. This application supports research into mitochondrial diseases and evolutionary genetics .

Genetic and Functional Studies

Whole-genome resequencing of Branchiostoma belcheri identified high polymorphism in mitochondrial genes, including ND6. Mutations in ND6 were associated with variations in intracellular digestion and oxidative phosphorylation efficiency .

Key Findings from B. belcheri Studies:

  • Mitochondrial Gene Diversity: 594 SNPs and 148 Indels were detected in the mitochondrial genome, with rare variants (MAF < 0.05) influencing digestive and immune functions .

  • Functional Impact: Mutations in ND6 and other Complex I subunits (e.g., ATP synthase subunit 6) may disrupt ATP production, highlighting evolutionary trade-offs between energy efficiency and genetic diversity .

Evolutionary Significance

Branchiostoma species exhibit extreme genetic diversity, with ND6 mutations reflecting adaptive responses to environmental pressures. For example, population expansions during interglacial periods (e.g., Greenlandian stage) may have driven selective pressures on mitochondrial genes .

Technical Limitations

  • Expression Hosts: E. coli may lack proper post-translational modifications critical for ND6 activity .

  • Partial Proteins: Some recombinant ND6 products are truncated, potentially limiting functional studies .

Data Tables

Table 2: Amino Acid Sequence (Partial)

RegionSequence
N-TerminalMQMmLMFLLLLAAIMVIRATSPYYGALATAWLALLAALLLLDADIIFPAIILmLIYLGGM
C-Terminal...YmLFDIYQRGSSMFIVAVMILTALLFSILEVVSHRQTTMKWFIHSTY

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order remarks, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Our proteins are standardly shipped with normal blue ice packs. If dry ice shipping is required, please inform us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, storage temperature, and the protein's inherent stability.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. The shelf life for lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
ND6; NAD6; NADH6; NADH-ubiquinone oxidoreductase chain 6; NADH dehydrogenase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-167
Protein Length
full length protein
Species
Branchiostoma floridae (Florida lancelet) (Amphioxus)
Target Names
ND6
Target Protein Sequence
MQMMLMFLLLLAAIMVIRATSPYYGALATAWLALLAALLLLDADIIFPAIILMLIYLGGM LVVFIYSTAYAADLMPLPINLTMSALMASFGVMLITMISSPSIETLCETKPWLVYDMQPS YMLFDIYQRGSSMFIVAVMILTALLFSILEVVSHRQTTMKWFIHSTY
Uniprot No.

Target Background

Function
This protein is the core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). It is believed to be part of the minimal assembly required for catalysis. Complex I plays a role in transferring electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
Database Links

KEGG: bfo:ND6

Protein Families
Complex I subunit 6 family
Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein.

Q&A

What is NADH-ubiquinone oxidoreductase chain 6 (ND6) in Branchiostoma floridae?

NADH-ubiquinone oxidoreductase chain 6 (ND6) is a mitochondrially-encoded protein that forms a critical component of Complex I (NADH:ubiquinone oxidoreductase) in the electron transport chain. In Branchiostoma floridae, this protein plays an essential role in cellular respiration by catalyzing electron transfer from NADH to ubiquinone. ND6 is encoded by the mitochondrial genome, which in Branchiostoma has an organization similar to that of humans . As a membrane-embedded subunit, ND6 contributes to proton translocation across the inner mitochondrial membrane, helping establish the electrochemical gradient necessary for ATP synthesis.

How does B. floridae ND6 differ structurally from vertebrate homologs?

B. floridae ND6 shows significant conservation with vertebrate homologs while maintaining distinct evolutionary characteristics reflecting its position as a basal chordate. Key structural differences include:

  • Specific amino acid substitutions in transmembrane domains that may influence proton pumping efficiency

  • Modified hydrophobic regions that potentially adapt to the unique cellular environment of cephalochordates

  • Sequence variations in functional domains that may affect interactions with other Complex I subunits

These differences provide valuable insights into the evolutionary trajectory of mitochondrial proteins from invertebrate chordates to vertebrates. The genome sequencing of B. floridae has significantly advanced our understanding of these evolutionary relationships .

What is the evolutionary significance of studying ND6 in Branchiostoma floridae?

Studying ND6 in B. floridae offers unique evolutionary insights for several reasons:

  • As cephalochordates represent the most basal chordate lineage, their mitochondrial proteins provide a window into ancestral chordate conditions before the emergence of vertebrates .

  • The genetic diversity identified in Branchiostoma populations (approximately 12% genome-wide variation) creates natural experiments for understanding functional constraints on mitochondrial proteins .

  • Comparison of ND6 sequence and function between B. floridae and vertebrates helps reconstruct the evolutionary modifications that accompanied the transition to vertebrate complexity.

  • The conservation of mitochondrial genome organization between Branchiostoma and humans makes it an excellent model for studying fundamental aspects of mitochondrial function .

Demographic analysis of Branchiostoma populations has revealed historical expansions correlated with climate changes, potentially creating selective pressures that influenced mitochondrial protein evolution .

What are the optimal methods for cloning and expressing recombinant B. floridae ND6?

The optimal approach for cloning and expressing recombinant B. floridae ND6 involves several strategic considerations:

DNA Source and Amplification:

  • Direct amplification from B. floridae mitochondrial DNA using PCR with primers designed based on published genome sequences .

  • Alternatively, synthesizing the gene based on the sequence from the B. floridae Gene Collection (Release 1), which contains comprehensive cDNA resources .

Expression Systems:

  • Bacterial expression systems often struggle with membrane proteins like ND6. The recommended approach employs modified E. coli strains (C41/C43) designed for membrane protein expression.

  • For more native-like protein production, insect cell-based systems (Sf9, Hi5) with baculovirus vectors provide superior folding environments.

  • Cell-free expression systems supplemented with lipids represent an emerging alternative for difficult membrane proteins.

Solubilization and Purification:

  • Two-step extraction using mild detergents (DDM or LMNG) followed by affinity chromatography with polyhistidine tags.

  • Size exclusion chromatography in detergent micelles to achieve final purity.

The expression challenges mirror those faced when studying human mitochondrial proteins, as the gene organization of Branchiostoma mitochondrial genomes closely resembles that of humans .

How can researchers validate the functional integrity of recombinant ND6 protein?

Validating functional integrity of recombinant ND6 requires multiple complementary approaches:

Structural Validation:

  • Circular dichroism spectroscopy to confirm proper secondary structure formation

  • Limited proteolysis assays to verify folding quality

  • Thermal shift assays to assess protein stability in various detergent environments

Functional Assays:

  • NADH:ubiquinone oxidoreductase activity assays using artificial electron acceptors

  • Reconstitution into liposomes to measure proton translocation capacity

  • Membrane potential measurements using potential-sensitive fluorescent dyes

Integration Testing:

  • Co-purification with other Complex I subunits to verify interaction capabilities

  • Complementation assays in ND6-deficient cell lines, potentially using the gene editing approaches described for mitochondrial proteins

For enhanced validation, researchers can employ CRISPR-Cas9 methodology to create knockout cell lines as negative controls, similar to the approach used for other mitochondrial proteins described in the literature .

What challenges are associated with generating antibodies against B. floridae ND6?

Generating specific antibodies against B. floridae ND6 presents several distinctive challenges:

Antigenicity Limitations:

  • ND6 is highly hydrophobic with few exposed epitopes, limiting potential antibody binding sites

  • Conformational epitopes often collapse during immunization procedures

  • The protein's small size (~20 kDa) provides limited unique epitopes

Strategic Approaches:

  • Synthetic peptide strategy: Targeting the most hydrophilic regions (N-terminal or loop regions) for peptide synthesis and conjugation to carrier proteins

  • Recombinant fragment approach: Expressing soluble domains or fusion constructs that maintain native folding of key epitopes

  • Genetic immunization: Using DNA vaccines encoding ND6 to generate in vivo expression

Validation Requirements:

  • Extensive cross-reactivity testing against other Complex I subunits

  • Confirmation using ND6-knockout samples as negative controls

  • Parallel validation with multiple antibodies targeting different epitopes

The high genetic diversity observed in Branchiostoma populations (approximately 3% variation per individual) further complicates antibody development by introducing potential epitope variations .

How can researchers investigate the impact of naturally occurring mutations on B. floridae ND6 function?

Investigating naturally occurring ND6 mutations requires a multilevel experimental design:

Mutation Identification:

  • Whole genome sequencing of multiple B. floridae individuals to identify naturally occurring variants in ND6, building on existing population genomic resources

  • Targeted sequencing of mitochondrial DNA from geographically diverse populations

  • Comparative analysis to identify conservation patterns and mutational hotspots

Functional Characterization:

  • Site-directed mutagenesis to introduce identified variants into recombinant expression systems

  • Enzymatic activity assays to quantify NADH oxidation rates and electron transfer efficiency

  • Structural analysis using advanced techniques like cryo-EM to visualize conformational changes

  • Proton pumping assays to assess the impact on membrane potential generation

Cellular Phenotype Analysis:

  • Creation of cellular models expressing variant ND6 using genetic replacement strategies

  • Measurements of cellular respiration, ATP production, and reactive oxygen species generation

  • Assessment of mitochondrial morphology and distribution

  • Stress response evaluations under various metabolic conditions

The extremely high genetic diversity reported in Branchiostoma populations (~12% genome-wide) makes this organism particularly valuable for studying natural ND6 variants and their functional consequences .

What computational approaches can predict the structural impact of ND6 mutations?

Modern computational approaches for predicting ND6 mutation impacts include:

Homology Modeling and Structure Prediction:

  • AlphaFold2 or RoseTTAFold for generating high-confidence structural models

  • Molecular dynamics simulations to assess conformational stability in membrane environments

  • Energy minimization calculations to predict folding efficiency

Mutation Effect Prediction:

  • PROVEAN, PolyPhen-2, and SIFT analyses adapted for mitochondrial proteins

  • Evolutionary constraint analysis using multiple sequence alignments across diverse taxa

  • Contact map predictions to identify disruptions to critical protein-protein interactions

System-Level Modeling:

  • Integration with Complex I structural models to predict assembly consequences

  • Molecular docking simulations to assess impacts on substrate and inhibitor binding

  • Electrostatics calculations to estimate changes in proton translocation efficiency

These computational approaches can be particularly valuable when analyzing the extensive variants identified in population studies of Branchiostoma, where approximately 594 SNPs and 148 indels have been detected in the mitochondrial genome .

How can researchers establish B. floridae ND6 interactome within Complex I?

The ND6 interactome can be established through these complementary approaches:

Crosslinking Mass Spectrometry (XL-MS):

  • Chemical crosslinking of purified Complex I followed by proteomic analysis

  • Identification of distance constraints between ND6 and neighboring subunits

  • Mapping of interaction interfaces through crosslink-guided modeling

Proximity Labeling Techniques:

  • APEX2 or BioID fusion constructs with ND6 to identify proximal proteins in living cells

  • Quantitative analysis of biotinylated proteins to establish interaction hierarchies

  • Temporal analysis to capture dynamic assembly intermediates

Co-Immunoprecipitation Studies:

  • Development of epitope-tagged ND6 constructs that preserve functionality

  • Targeted pulldown of ND6-containing complexes followed by mass spectrometry

  • Validation of identified interactions through reciprocal co-immunoprecipitation

Functional Genomics Approaches:

  • CRISPR-Cas9 screening to identify genetic modifiers of ND6 function

  • Synthetic genetic interaction mapping to discover functional relationships

  • Suppressor screens to identify compensatory mechanisms for ND6 defects

The cDNA resources available for B. floridae, including the comprehensive Gene Collection Release 1 with over 21,000 unique transcripts, provide valuable tools for these interactome studies .

How can CRISPR-Cas9 be optimized for editing the ND6 gene in B. floridae?

Optimizing CRISPR-Cas9 for mitochondrial ND6 editing requires specialized approaches:

Delivery Systems:

  • Mitochondrially-targeted CRISPR systems using mitochondrial localization sequences

  • Packaging in mitochondriotropic nanoparticles to enhance organelle-specific delivery

  • Temporal control using inducible expression systems to minimize off-target effects

Guide RNA Design:

  • Careful targeting to avoid regions with high population variability (given the ~3% individual genetic variation)

  • Consideration of mitochondrial genetic code differences when designing guides

  • Utilization of predictive algorithms optimized for organellar genomes

Validation Strategy:

  • PCR amplification and sequencing of targeted regions, similar to approaches used for other mitochondrial genes

  • Functional assessment through activity assays and respiratory chain analysis

  • Single-cell isolation and expansion to establish edited clonal lines

Technical Considerations:

  • Optimization of homology-directed repair templates for precise editing

  • Implementation of base editing or prime editing technologies for specific changes

  • Development of selection markers compatible with mitochondrial biology

This approach builds upon established CRISPR methodologies for other mitochondrial genes, adapted for the specific challenges of working with Branchiostoma .

What methods are most effective for analyzing B. floridae ND6 expression patterns during development?

Analyzing ND6 expression patterns during Branchiostoma development requires specialized techniques:

Transcript Analysis:

  • Quantitative RT-PCR optimized for mitochondrial transcripts

  • RNA-Seq with specific mitochondrial RNA extraction protocols

  • In situ hybridization using probes designed for the high A+T content typical of mitochondrial genes

Protein Localization:

  • Immunohistochemistry with validated anti-ND6 antibodies

  • Generation of fluorescent protein fusions that maintain proper mitochondrial targeting

  • Electron microscopy with immunogold labeling for subcellular resolution

Single-Cell Approaches:

  • Single-cell RNA-Seq to capture cell-type specific expression patterns

  • Tissue-specific isolation of mitochondria followed by proteomic analysis

  • Spatial transcriptomics to map expression across developing embryos

Developmental Timeline Analysis:

  • Stage-specific sampling across key developmental transitions

  • Correlation with expression patterns of developmental markers like Vasa and Nanos, which show specific asymmetric localization during early amphioxus development

  • Integration with data from the B. floridae Gene Collection, which includes cDNA from five developmental stages

These methods can utilize the extensive cDNA resources available for B. floridae, which include approximately 140,000 cDNA clones derived from various developmental stages .

How can researchers establish conditional knockout systems for B. floridae ND6?

Establishing conditional knockout systems for ND6 requires innovative approaches adapted to mitochondrial genetics:

Inducible Expression Systems:

  • Design of rescue constructs with nuclear-encoded, mitochondrially-targeted ND6 under inducible control

  • Implementation of heterologous recombination systems (Cre-loxP, PhiC31) for conditional expression

  • Development of tetracycline-responsive elements adapted for mitochondrial gene expression

Mitochondrial DNA Manipulation:

  • Adaptation of mitochondrial transfection techniques for targeted deletion

  • Generation of heteroplasmic states with controlled ratios of wild-type and modified mtDNA

  • Cybrid approaches similar to those described for human cells, involving fusion with mitochondrially-deficient cells

Validation and Analysis:

  • PCR-based genotyping to confirm genetic modifications

  • Quantitative assessment of heteroplasmy levels

  • Functional assays including oxygen consumption, ATP production, and complex assembly

Alternative Approaches:

  • Protein destabilization methods using degron tags

  • RNA interference adapted for mitochondrial transcripts

  • Small molecule inhibitors with specificity for amphioxus ND6

These approaches build on established methods for conditional knockout of other mitochondrial proteins, such as TFAM, which have been successful in mammalian cell systems .

What are the optimal conditions for obtaining high-resolution structural data of B. floridae ND6?

Obtaining high-resolution structural data for B. floridae ND6 requires specialized approaches:

Sample Preparation:

  • Detergent screening to identify optimal solubilization conditions (common options: LMNG, GDN, or digitonin)

  • Lipid nanodisc reconstitution to provide a native-like membrane environment

  • Preparation of stable Complex I assemblies rather than isolated ND6

Cryo-EM Optimization:

  • Grid preparation with thin ice layers to enhance particle visibility

  • Multiple data collection strategies to capture diverse orientations

  • Advanced image processing approaches to handle the conformational heterogeneity typical of Complex I

Crystallization Alternatives:

  • Lipidic cubic phase crystallization adapted for membrane proteins

  • Antibody fragment (Fab) co-crystallization to provide additional crystal contacts

  • Surface entropy reduction through targeted mutagenesis of exposed residues

Complementary Approaches:

These approaches account for the challenges posed by membrane proteins and leverage the unique properties of Branchiostoma proteins, which represent an evolutionary intermediate state between invertebrates and vertebrates .

How can researchers accurately measure the enzymatic activity of recombinant B. floridae ND6?

Accurate enzymatic activity measurement requires specialized assays:

NADH Oxidation Assays:

  • Spectrophotometric monitoring of NADH absorbance at 340 nm

  • Fluorescence-based assays detecting NADH autofluorescence

  • Coupled enzyme systems for enhanced sensitivity

Electron Transfer Measurements:

  • Artificial electron acceptor (ferricyanide, DCPIP) reduction kinetics

  • Oxygen consumption measurements using Clark-type electrodes

  • Membrane potential generation using voltage-sensitive dyes

Reconstitution Systems:

  • Proteoliposome reconstitution for proton pumping assays

  • Nanodiscs for controlled lipid environment studies

  • Co-reconstitution with other respiratory chain components

Data Analysis:

  • Michaelis-Menten kinetic parameter determination

  • Inhibitor sensitivity profiling

  • pH and temperature dependence characterization

ParameterMeasurement TechniqueExpected Range for ND6
NADH OxidationAbsorbance decrease at 340 nm50-200 nmol/min/mg
Proton PumpingACMA fluorescence quenching2-4 H⁺/e⁻ ratio
Electron TransferCytochrome c reduction rate10-50 s⁻¹
ROS ProductionAmplex Red/HRP assay1-5% of electron flux

These approaches can be particularly valuable for characterizing the functional impacts of the extensive genetic diversity observed in Branchiostoma populations .

What techniques can differentiate between direct and indirect effects of ND6 mutations on Complex I assembly?

Differentiating direct from indirect effects of ND6 mutations requires multilevel analysis:

Assembly Intermediate Characterization:

  • Blue native PAGE to visualize Complex I assembly states

  • Sucrose gradient ultracentrifugation to separate assembly intermediates

  • Pulse-chase labeling to track assembly kinetics

Interaction Analysis:

  • Proximity labeling with APEX2 or BioID fusions to ND6 variants

  • Crosslinking mass spectrometry to map interaction interfaces

  • Surface plasmon resonance to quantify binding affinities with assembly factors

Structural Validation:

  • Single-particle cryo-EM of partially assembled complexes

  • Hydrogen/deuterium exchange to identify structural perturbations

  • Computational modeling of assembly pathways

Functional Correlations:

  • Activity measurements of assembly intermediates

  • ROS production assessment at different assembly stages

  • Membrane potential generation by partially assembled complexes

This multi-faceted approach can leverage the gene editing and cybrid techniques established for mitochondrial proteins to create controlled experimental systems .

How does B. floridae ND6 compare functionally with homologs from other species?

Comparative functional analysis of ND6 across species reveals evolutionary insights:

Enzymatic Properties:

  • Kinetic parameters (Km, Vmax) comparison across evolutionary lineages

  • Inhibitor sensitivity profiles reflecting binding pocket conservation

  • Temperature and pH optima correlating with physiological conditions

Structural Features:

  • Conservation of key transmembrane domains across chordates

  • Lineage-specific insertions/deletions in loop regions

  • Patterns of coevolution with interacting subunits

Regulatory Mechanisms:

  • Post-translational modification sites and their conservation

  • Transcriptional and translational control mechanisms

  • Protein stability and turnover rates

Evolutionary Context:
The position of Branchiostoma as a basal chordate makes its ND6 protein particularly valuable for understanding the transition from invertebrate to vertebrate mitochondrial function . The high genetic diversity observed in Branchiostoma populations (approximately 12% genome-wide variation) provides natural experiments for understanding functional constraints on this protein .

What insights can genomic analysis provide about selection pressures on B. floridae ND6?

Genomic analysis reveals multiple dimensions of selection on ND6:

Sequence Conservation Patterns:

  • Calculation of dN/dS ratios across protein domains

  • Identification of positively and negatively selected sites

  • Comparison of conservation patterns across evolutionary lineages

Population Genetic Signatures:

  • Analysis of site frequency spectra to detect selective sweeps

  • Identification of mutations correlated with environmental factors

  • Linkage disequilibrium patterns indicative of epistatic selection

Structural Mapping:

  • Correlation of conserved residues with functional domains

  • Visualization of selective constraints on protein structure

  • Identification of coevolving residue networks

Demographic Context:
Population genomic studies have identified over 52 million variations (~12% of the total genome) in Branchiostoma populations . This exceptional diversity provides a rich dataset for detecting selection signals against the background of neutral evolution. Demographic analysis has revealed population expansions during interglacial periods, potentially creating unique selection pressures on mitochondrial genes .

How can researchers trace the evolutionary history of ND6 function from invertebrates to vertebrates?

Tracing ND6 evolutionary history requires integrative approaches:

Phylogenetic Analysis:

  • Construction of gene trees using sequences from diverse taxa

  • Ancestral sequence reconstruction to infer transitional states

  • Reconciliation with species trees to identify gene duplication/loss events

Functional Comparison:

  • Heterologous expression of ancestral and extant ND6 variants

  • Measurement of biochemical properties across evolutionary lineages

  • Complementation assays in model systems to test functional equivalence

Structural Evolution:

  • Mapping of key evolutionary transitions onto protein structures

  • Identification of coevolving residue networks across lineages

  • Analysis of interface evolution between ND6 and other Complex I subunits

Genomic Context:

  • Analysis of synteny and gene arrangement across mitochondrial genomes

  • Comparison of regulatory elements controlling expression

  • Evaluation of codon usage and compositional biases

The position of Branchiostoma as a basal chordate, with mitochondrial genome organization similar to humans, makes it an ideal model for understanding this evolutionary trajectory .

How can gene editing techniques be applied to create reporter systems for B. floridae ND6?

Creating ND6 reporter systems requires specialized approaches for mitochondrial applications:

Nuclear-Encoded Reporters:

  • Design of split fluorescent proteins with one half fused to nuclear-encoded mitochondrial proteins and the other to ND6

  • Development of luciferase complementation assays for real-time monitoring in living cells

  • FRET-based sensors to detect ND6 interactions or conformational changes

Mitochondrially-Targeted Editing:

  • Adaptation of base editors for mitochondrial DNA modification

  • Integration of small epitope tags into the ND6 locus using precise editing techniques

  • Development of inducible expression systems for mitochondrially-targeted RNA imaging probes

Validation Strategies:

  • PCR-based genotyping similar to approaches used for other mitochondrial genes

  • Fluorescence microscopy to confirm proper mitochondrial localization

  • Functional assays to ensure reporter constructs don't disrupt normal activity

Applications:

  • Real-time monitoring of ND6 expression during development

  • Screening assays for compounds affecting Complex I assembly or function

  • In vivo imaging of mitochondrial dynamics in different tissues

These approaches build on established methods for gene editing and reporter creation, adapted for the specific challenges of mitochondrial genes in Branchiostoma .

What high-throughput screening methods can identify compounds affecting B. floridae ND6 function?

Effective high-throughput screening requires specialized assays for ND6:

Activity-Based Screens:

  • Plate-based NADH oxidation assays with colorimetric readouts

  • Oxygen consumption measurements in 384-well format

  • Membrane potential-sensitive dye assays optimized for automation

Binding Assays:

  • Thermal shift assays to detect ligand-induced stabilization

  • Fluorescence polarization for direct binding measurement

  • Surface plasmon resonance adapted for membrane proteins

Cellular Phenotype Screens:

  • ATP production in cells expressing B. floridae ND6

  • Mitochondrial morphology using automated microscopy

  • ROS production as an indicator of Complex I dysfunction

Data Analysis Approaches:

  • Machine learning algorithms to identify structure-activity relationships

  • Network pharmacology to understand pathway-level effects

  • Comparison with effects on ND6 from other species to identify selective compounds

These screening approaches can leverage the conditional expression systems developed for mitochondrial proteins to create appropriate cellular backgrounds for compound testing .

How can researchers develop B. floridae ND6 as a tool for understanding human mitochondrial disorders?

Developing B. floridae ND6 as a translational research tool involves:

Comparative Mutation Analysis:

  • Mapping human pathogenic mutations onto B. floridae ND6 structure

  • Creating equivalent mutations in recombinant systems for functional analysis

  • Comparing phenotypic effects between human and amphioxus systems

Model System Development:

  • Generation of "humanized" amphioxus systems expressing human ND6 variants

  • Development of heterologous expression systems in human cells lacking endogenous ND6

  • Creation of hybrid Complex I assemblies to test subunit compatibility

Therapeutic Screening Platforms:

  • Adaptation of B. floridae ND6 assays for compound screening

  • Identification of suppressors of mutation-induced dysfunction

  • Testing of gene therapy approaches using amphioxus as a simplified system

Evolutionary Medicine Insights:

  • Analysis of natural variation in amphioxus populations to identify potential compensatory mechanisms

  • Understanding the structural basis of resistance to dysfunction in evolutionarily older systems

  • Identification of conserved vs. species-specific aspects of ND6 pathophysiology

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.